BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0264 384705 385082 126 !not a gene! (126 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71196 hypothetical protein PH1841 - Pyrococcus horikoshii ... 132 2e-30 pir||C72479 hypothetical protein APE2475 - Aeropyrum pernix (str... 90 6e-18 >pir||C71196 hypothetical protein PH1841 - Pyrococcus horikoshii >gi|3258279|dbj|BAA30962.1| (AP000007) 141aa long hypothetical protein [Pyrococcus horikoshii] Length = 141 Score = 132 bits (328), Expect = 2e-30 Identities = 70/93 (75%), Positives = 78/93 (83%) Query: 34 IALSIILVNLPSLLKSSSILSTSSFLKSGSIGIPLVCIWSISFLPCLSGTPTSISLSNLP 93 +ALS+ +N PS L S ILSTSSFLKSGSIGIPLV I SISFLPCLSGTPTSISLS P Sbjct: 1 MALSMTSLNFPSFLSPSRILSTSSFLKSGSIGIPLVWICSISFLPCLSGTPTSISLSKRP 60 Query: 94 GLLRAGSMASGLLVAPMTMTLPLLLRPSINANS 126 GLL+AGS ASGLLVAP+T+TLPL +PSI A+S Sbjct: 61 GLLKAGSKASGLLVAPITITLPLPFKPSIKASS 93 >pir||C72479 hypothetical protein APE2475 - Aeropyrum pernix (strain K1) >gi|5106180|dbj|BAA81491.1| (AP000064) 353aa long hypothetical protein [Aeropyrum pernix] Length = 353 Score = 90.5 bits (221), Expect = 6e-18 Identities = 56/102 (54%), Positives = 66/102 (63%) Query: 25 SSLLLLTSSIALSIILVNLPSLLKSSSILSTSSFLKSGSIGIPLVCIWSISFLPCLSGTP 84 S L + +A S+ + +K I ++ S S + GI LVCI SIS LPCLSG Sbjct: 204 SGRYLRRAYMAASLARAARSAPVKPLVISASFSRSMSSARGICLVCICSISSLPCLSGKG 263 Query: 85 TSISLSNLPGLLRAGSMASGLLVAPMTMTLPLLLRPSINANS 126 TSISLSNLPGLLRAGSMA GLLVA MT+TLPL PS+ A S Sbjct: 264 TSISLSNLPGLLRAGSMALGLLVAAMTITLPLASSPSMRARS 305 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.132 0.360 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39679093 Number of Sequences: 2977 Number of extensions: 1462567 Number of successful extensions: 5630 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5627 Number of HSP's gapped (non-prelim): 3 length of query: 126 length of database: 189,106,746 effective HSP length: 58 effective length of query: 68 effective length of database: 154,394,500 effective search space: 10498826000 effective search space used: 10498826000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)