BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0268 (PAB0268) DE:Hypothetical protein (287 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75155 hypothetical protein PAB0268 - Pyrococcus abyssi (st... 575 e-163 >pir||B75155 hypothetical protein PAB0268 - Pyrococcus abyssi (strain Orsay) >gi|5457831|emb|CAB49321.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 287 Score = 575 bits (1465), Expect = e-163 Identities = 287/287 (100%), Positives = 287/287 (100%) Query: 1 MDIRVITMGLPMNPLTAFTLAFLLYITHGFYLSGFIRPFQRRFGEIEGYWIAMSIFTVAF 60 MDIRVITMGLPMNPLTAFTLAFLLYITHGFYLSGFIRPFQRRFGEIEGYWIAMSIFTVAF Sbjct: 1 MDIRVITMGLPMNPLTAFTLAFLLYITHGFYLSGFIRPFQRRFGEIEGYWIAMSIFTVAF 60 Query: 61 AVLITLLCPELYFVSWSFPIDYFLLFLSLSFLAFIPTVFELRKPESPEISDEGVNLVKSM 120 AVLITLLCPELYFVSWSFPIDYFLLFLSLSFLAFIPTVFELRKPESPEISDEGVNLVKSM Sbjct: 61 AVLITLLCPELYFVSWSFPIDYFLLFLSLSFLAFIPTVFELRKPESPEISDEGVNLVKSM 120 Query: 121 GFKDVALLQVISAALPEELVFRYVFLGLLSLWNPFASLIALSIFFGIGHKFSHPNRNWNV 180 GFKDVALLQVISAALPEELVFRYVFLGLLSLWNPFASLIALSIFFGIGHKFSHPNRNWNV Sbjct: 121 GFKDVALLQVISAALPEELVFRYVFLGLLSLWNPFASLIALSIFFGIGHKFSHPNRNWNV 180 Query: 181 LISNALIGFVLGLAYLYTKSLPVVMAIHWLDDMVPWAFIKYERVRGAIAGATALLAVLPL 240 LISNALIGFVLGLAYLYTKSLPVVMAIHWLDDMVPWAFIKYERVRGAIAGATALLAVLPL Sbjct: 181 LISNALIGFVLGLAYLYTKSLPVVMAIHWLDDMVPWAFIKYERVRGAIAGATALLAVLPL 240 Query: 241 VLLWDKLVSVIEYLRGIYSNEGLVLGSGIAIIMLGVVYLGLRLLKSR 287 VLLWDKLVSVIEYLRGIYSNEGLVLGSGIAIIMLGVVYLGLRLLKSR Sbjct: 241 VLLWDKLVSVIEYLRGIYSNEGLVLGSGIAIIMLGVVYLGLRLLKSR 287 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.331 0.147 0.455 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104356810 Number of Sequences: 2977 Number of extensions: 4402978 Number of successful extensions: 14073 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14072 Number of HSP's gapped (non-prelim): 1 length of query: 287 length of database: 189,106,746 effective HSP length: 49 effective length of query: 238 effective length of database: 159,780,883 effective search space: 38027850154 effective search space used: 38027850154 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 165 (68.7 bits)