BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0324 (PAB0324) DE:Hypothetical protein (117 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75165 hypothetical protein PAB0324 - Pyrococcus abyssi (st... 245 1e-64 pir||D71131 hypothetical protein PH0817 - Pyrococcus horikoshii ... 96 1e-19 >pir||H75165 hypothetical protein PAB0324 - Pyrococcus abyssi (strain Orsay) >gi|5457917|emb|CAB49407.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 117 Score = 245 bits (619), Expect = 1e-64 Identities = 117/117 (100%), Positives = 117/117 (100%) Query: 1 MSQFTPTSDLARKAIDTVRKALPLFIPAPPIVHRDPEGYHIDVPILYMDFAVDRVHFNAE 60 MSQFTPTSDLARKAIDTVRKALPLFIPAPPIVHRDPEGYHIDVPILYMDFAVDRVHFNAE Sbjct: 1 MSQFTPTSDLARKAIDTVRKALPLFIPAPPIVHRDPEGYHIDVPILYMDFAVDRVHFNAE 60 Query: 61 TNAPFPKGSPVSSKVPPKSEEVVERMKAILEESRVLEACEFRKPERAWVVPWHGRAS 117 TNAPFPKGSPVSSKVPPKSEEVVERMKAILEESRVLEACEFRKPERAWVVPWHGRAS Sbjct: 61 TNAPFPKGSPVSSKVPPKSEEVVERMKAILEESRVLEACEFRKPERAWVVPWHGRAS 117 >pir||D71131 hypothetical protein PH0817 - Pyrococcus horikoshii >gi|3257227|dbj|BAA29910.1| (AP000003) 153aa long hypothetical protein [Pyrococcus horikoshii] Length = 153 Score = 96.3 bits (236), Expect = 1e-19 Identities = 48/101 (47%), Positives = 70/101 (68%), Gaps = 5/101 (4%) Query: 11 ARKAIDTVRKALPLFIPAPPIVHRDPEGYHIDVPILYMDFAVDRVHFNAETNAPFPKGSP 70 A KAI VR ALPLF P++ P+G +DVPILY++FA+DR+H++ + P PKG P Sbjct: 23 AEKAIKLVRNALPLFRVGKPLIK--PDG--VDVPILYLNFAIDRLHYDPKKERPLPKGCP 78 Query: 71 VSSKVPPKSEEVVERMKAILEESRVLEACEFRKPERAWVVP 111 SS+ + E+ E+++ ILEE+++L A EFR+PE W+VP Sbjct: 79 RSSRA-GEVGEIEEKVEKILEEAKILPAAEFREPENCWIVP 118 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.136 0.418 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47666241 Number of Sequences: 2977 Number of extensions: 1911730 Number of successful extensions: 5113 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5110 Number of HSP's gapped (non-prelim): 2 length of query: 117 length of database: 189,106,746 effective HSP length: 50 effective length of query: 67 effective length of database: 159,182,396 effective search space: 10665220532 effective search space used: 10665220532 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)