BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0353 496366 496842 159 !not a gene! (159 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71045 hypothetical protein PH1649 - Pyrococcus horikoshii ... 133 8e-31 >pir||A71045 hypothetical protein PH1649 - Pyrococcus horikoshii >gi|3258078|dbj|BAA30761.1| (AP000006) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 133 bits (332), Expect = 8e-31 Identities = 71/110 (64%), Positives = 79/110 (71%) Query: 22 NHIQNGASEGCSPLKLRCQEKLAMNSSSHGMNPMAFIMVISGIKNETMGRTSPEIKYSLR 81 NH QNGAS GCSPLKLRCQEKL +NSSS G+ P+AFI+ ISG +N G T+PEI SLR Sbjct: 2 NHSQNGASAGCSPLKLRCQEKLPINSSSQGIKPIAFIIGISGTRNAITGSTTPEIMNSLR 61 Query: 82 SFSFSILNQRIGKAKAPLSLVAAAKPSAIPLSLILSRAKKSIKRAMKKAT 131 S S SIL Q IG APLS VAAA P IPL L L + S+KRA KKAT Sbjct: 62 SSSLSILAQSIGNTNAPLSFVAAASPKEIPLILSLLIVRNSMKRATKKAT 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.312 0.124 0.336 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49874545 Number of Sequences: 2977 Number of extensions: 1696568 Number of successful extensions: 3163 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3162 Number of HSP's gapped (non-prelim): 1 length of query: 159 length of database: 189,106,746 effective HSP length: 63 effective length of query: 96 effective length of database: 151,402,065 effective search space: 14534598240 effective search space used: 14534598240 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 161 (67.1 bits)