BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0387 (PAB0387) DE:Hypothetical protein (130 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75175 hypothetical protein PAB0387 - Pyrococcus abyssi (st... 277 4e-74 pir||G71038 hypothetical protein PH1599 - Pyrococcus horikoshii ... 248 2e-65 >pir||G75175 hypothetical protein PAB0387 - Pyrococcus abyssi (strain Orsay) >gi|5457996|emb|CAB49486.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 130 Score = 277 bits (701), Expect = 4e-74 Identities = 130/130 (100%), Positives = 130/130 (100%) Query: 1 MNERKKKPIDEFPWQEYDLDEFRKKFPALAKELEEKSGIEIGGIRLDEYQVLEEEEEDKI 60 MNERKKKPIDEFPWQEYDLDEFRKKFPALAKELEEKSGIEIGGIRLDEYQVLEEEEEDKI Sbjct: 1 MNERKKKPIDEFPWQEYDLDEFRKKFPALAKELEEKSGIEIGGIRLDEYQVLEEEEEDKI 60 Query: 61 DFSGYNPTVIDFLRRCETEEEALEIINWMEKQGEITPEMAKALRVTLVHKGVRAFGPKKE 120 DFSGYNPTVIDFLRRCETEEEALEIINWMEKQGEITPEMAKALRVTLVHKGVRAFGPKKE Sbjct: 61 DFSGYNPTVIDFLRRCETEEEALEIINWMEKQGEITPEMAKALRVTLVHKGVRAFGPKKE 120 Query: 121 WGWYERHGKH 130 WGWYERHGKH Sbjct: 121 WGWYERHGKH 130 >pir||G71038 hypothetical protein PH1599 - Pyrococcus horikoshii >gi|3258028|dbj|BAA30711.1| (AP000006) 194aa long hypothetical protein [Pyrococcus horikoshii] Length = 194 Score = 248 bits (626), Expect = 2e-65 Identities = 115/131 (87%), Positives = 125/131 (94%), Gaps = 1/131 (0%) Query: 1 MNERKKKPIDEFPWQEYDLDEFRKKFPALAKELEEKSG-IEIGGIRLDEYQVLEEEEEDK 59 M ++KKKPIDE PWQEYD++EF++KFPALAKELEE G +EI GIRLDEYQVLEEEEE+K Sbjct: 64 MTKKKKKPIDELPWQEYDIEEFKEKFPALAKELEENFGDLEITGIRLDEYQVLEEEEEEK 123 Query: 60 IDFSGYNPTVIDFLRRCETEEEALEIINWMEKQGEITPEMAKALRVTLVHKGVRAFGPKK 119 IDFSGYNPTVIDFLRRC+TEEEALEIINW+EKQGEITPEMAKALRVTLVHKGVRAFGPKK Sbjct: 124 IDFSGYNPTVIDFLRRCDTEEEALEIINWLEKQGEITPEMAKALRVTLVHKGVRAFGPKK 183 Query: 120 EWGWYERHGKH 130 EWGWYERHGKH Sbjct: 184 EWGWYERHGKH 194 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.138 0.417 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54133468 Number of Sequences: 2977 Number of extensions: 2287706 Number of successful extensions: 5840 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5837 Number of HSP's gapped (non-prelim): 2 length of query: 130 length of database: 189,106,746 effective HSP length: 51 effective length of query: 79 effective length of database: 158,583,909 effective search space: 12528128811 effective search space used: 12528128811 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 161 (67.1 bits)