BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0388 539128 539487 120 !not a gene! (120 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71038 hypothetical protein PH1597 - Pyrococcus horikoshii ... 115 2e-25 >pir||E71038 hypothetical protein PH1597 - Pyrococcus horikoshii >gi|3258026|dbj|BAA30709.1| (AP000006) 100aa long hypothetical protein [Pyrococcus horikoshii] Length = 100 Score = 115 bits (285), Expect = 2e-25 Identities = 64/99 (64%), Positives = 71/99 (71%) Query: 22 GTSTIRAPFFATFMRTSVSTSYLSLSISGRNSLLIALNPLCVSSTFCFIFALIKVVVMKL 81 GTS I APFF FMRTSVSTSYLSLSI+G NSLLIAL PL VS F + ++I +VVMKL Sbjct: 2 GTSKILAPFFIAFMRTSVSTSYLSLSITGTNSLLIALKPLWVSRIFFLVLSVINLVVMKL 61 Query: 82 LSFLTKGLFPAFITLLPITKSASPLIIGAMILGISFGSC 120 L FL GLFP I LLP+TKSA P +G L IS G C Sbjct: 62 LIFLDIGLFPLVIILLPMTKSALPSTMGFTNLYISLGLC 100 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.140 0.404 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35445389 Number of Sequences: 2977 Number of extensions: 1145350 Number of successful extensions: 5235 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5234 Number of HSP's gapped (non-prelim): 1 length of query: 120 length of database: 189,106,746 effective HSP length: 52 effective length of query: 68 effective length of database: 157,985,422 effective search space: 10743008696 effective search space used: 10743008696 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 160 (66.7 bits)