BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0402 555157 555459 101 !not a gene! (101 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71035 hypothetical protein PH1576 - Pyrococcus horikoshii ... 130 4e-30 >pir||H71035 hypothetical protein PH1576 - Pyrococcus horikoshii >gi|3258005|dbj|BAA30688.1| (AP000006) 119aa long hypothetical protein [Pyrococcus horikoshii] Length = 119 Score = 130 bits (323), Expect = 4e-30 Identities = 66/101 (65%), Positives = 75/101 (73%) Query: 1 MHTSAPLGTFNSLATAGHLALRRKKTLSSLSSLRVSKFPCPLAIMISLSSKILLNSSLTS 60 MHTSAPLGT +SLATAGHLA +RK L S SL VSKFPCP A+M S +NS LT+ Sbjct: 1 MHTSAPLGTLSSLATAGHLAFKRKNILLSFISLNVSKFPCPFAMMTSALLNASINSLLTN 60 Query: 61 LIGTPTILVPVETILPNLSNPSRFRSSTVTSLIIAPSFPAM 101 L GTPTILVPV+ P+ SNP+ F+SSTV S II PSFPAM Sbjct: 61 LRGTPTILVPVDITFPSFSNPALFKSSTVASFIIGPSFPAM 101 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.130 0.354 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31166872 Number of Sequences: 2977 Number of extensions: 954557 Number of successful extensions: 2772 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2771 Number of HSP's gapped (non-prelim): 1 length of query: 101 length of database: 189,106,746 effective HSP length: 58 effective length of query: 43 effective length of database: 154,394,500 effective search space: 6638963500 effective search space used: 6638963500 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 158 (66.0 bits)