BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0413 568719 569159 147 !not a gene! (147 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71033 hypothetical protein PH1556 - Pyrococcus horikoshii ... 202 1e-51 >pir||D71033 hypothetical protein PH1556 - Pyrococcus horikoshii >gi|3257985|dbj|BAA30668.1| (AP000006) 159aa long hypothetical protein [Pyrococcus horikoshii] Length = 159 Score = 202 bits (509), Expect = 1e-51 Identities = 112/146 (76%), Positives = 119/146 (80%) Query: 1 MLTLFTVSSSLRSFSSSVRCLTFSSISTSLGLTFILLLTKSSTGFISASSIFSFFVSDAD 60 MLTLFT SS R FSSS R L FSSISTSLGL FILLLTKSSTGFISAS IFSF VSDA Sbjct: 1 MLTLFTALSSFRRFSSSFRWLIFSSISTSLGLIFILLLTKSSTGFISASLIFSFLVSDAT 60 Query: 61 LASLYASFMASSSLLRSLVEEKPQAPLARTLIATPLLSFSVKLVNTPSLRVKVVLFRSSY 120 ASLYASFMASS+L SLV+EKPQAPL RTL+ATPL SFSVKL NTPS R+ VLF SSY Sbjct: 61 FASLYASFMASSTLSNSLVDEKPQAPLTRTLMATPLFSFSVKLTNTPSFRLSAVLFMSSY 120 Query: 121 LSSMYSALMFSSAHFKAFSKLSMFIT 146 LSSMYSAL+FSSA AFS+ S+ T Sbjct: 121 LSSMYSALIFSSAQRSAFSRASIGTT 146 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.130 0.341 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37935710 Number of Sequences: 2977 Number of extensions: 1187130 Number of successful extensions: 4929 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4928 Number of HSP's gapped (non-prelim): 1 length of query: 147 length of database: 189,106,746 effective HSP length: 62 effective length of query: 85 effective length of database: 152,000,552 effective search space: 12920046920 effective search space used: 12920046920 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)