BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0433 (PAB0433) DE:Hypothetical protein (115 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75183 hypothetical protein PAB0433 - Pyrococcus abyssi (st... 229 7e-60 pir||C71030 hypothetical protein PH1533 - Pyrococcus horikoshii ... 99 1e-20 >pir||H75183 hypothetical protein PAB0433 - Pyrococcus abyssi (strain Orsay) >gi|5458061|emb|CAB49551.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 115 Score = 229 bits (579), Expect = 7e-60 Identities = 115/115 (100%), Positives = 115/115 (100%) Query: 1 MKKGLFLYFLGLGLAIVKPPVVRLACMDISTGRVLTDIDPFFLVIELGFIFVGSYLMALS 60 MKKGLFLYFLGLGLAIVKPPVVRLACMDISTGRVLTDIDPFFLVIELGFIFVGSYLMALS Sbjct: 1 MKKGLFLYFLGLGLAIVKPPVVRLACMDISTGRVLTDIDPFFLVIELGFIFVGSYLMALS 60 Query: 61 HKFKSVHAMNGFIALASGIGAAFVGFYSDIFVLALFGAVLATIGLITYKLSRWFS 115 HKFKSVHAMNGFIALASGIGAAFVGFYSDIFVLALFGAVLATIGLITYKLSRWFS Sbjct: 61 HKFKSVHAMNGFIALASGIGAAFVGFYSDIFVLALFGAVLATIGLITYKLSRWFS 115 >pir||C71030 hypothetical protein PH1533 - Pyrococcus horikoshii >gi|3257960|dbj|BAA30643.1| (AP000006) 133aa long hypothetical protein [Pyrococcus horikoshii] Length = 133 Score = 99.5 bits (244), Expect = 1e-20 Identities = 51/109 (46%), Positives = 72/109 (65%), Gaps = 5/109 (4%) Query: 4 GLFLYFLGLGLAIVKPPVVRLACMDISTGRVLTDIDPFFLVIELGFIFVGSYLMALSHKF 63 G+ LY GL ++IVKPP+ RLACM + +G V T ++P L IELG I +GS L+A K Sbjct: 30 GIILYLSGLVMSIVKPPIERLACMVVPSGEVCTGVNPIILSIELGLILLGSMLLAQCSKE 89 Query: 64 KSVHAMNGFIALASGIGAAFVGFYSDIFVLALFGAVLATIGLITYKLSR 112 K G++A+++G+G A +G YS + L L GAVL ++GL+ YKL R Sbjct: 90 KL-----GWMAVSTGVGIAIIGGYSGLSSLVLLGAVLGSMGLVVYKLRR 133 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.334 0.150 0.452 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38499392 Number of Sequences: 2977 Number of extensions: 1337841 Number of successful extensions: 7445 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7443 Number of HSP's gapped (non-prelim): 2 length of query: 115 length of database: 189,106,746 effective HSP length: 46 effective length of query: 69 effective length of database: 161,576,344 effective search space: 11148767736 effective search space used: 11148767736 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.6 bits) S2: 160 (66.7 bits)