BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0438 (PAB0438) DE:Hypothetical protein (115 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75105 hypothetical protein PAB0438 - Pyrococcus abyssi (st... 238 1e-62 pir||D71029 hypothetical protein PH1526 - Pyrococcus horikoshii ... 234 3e-61 >pir||E75105 hypothetical protein PAB0438 - Pyrococcus abyssi (strain Orsay) >gi|5458069|emb|CAB49558.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 115 Score = 238 bits (602), Expect = 1e-62 Identities = 115/115 (100%), Positives = 115/115 (100%) Query: 1 MKVIKEWNVKVKLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF 60 MKVIKEWNVKVKLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF Sbjct: 1 MKVIKEWNVKVKLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF 60 Query: 61 FWEIKDNKYTGRILAGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE 115 FWEIKDNKYTGRILAGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE Sbjct: 61 FWEIKDNKYTGRILAGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE 115 >pir||D71029 hypothetical protein PH1526 - Pyrococcus horikoshii >gi|3257953|dbj|BAA30636.1| (AP000006) 136aa long hypothetical protein [Pyrococcus horikoshii] Length = 136 Score = 234 bits (590), Expect = 3e-61 Identities = 110/115 (95%), Positives = 114/115 (98%) Query: 1 MKVIKEWNVKVKLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF 60 M+VIKEWNVK+KLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF Sbjct: 22 MRVIKEWNVKIKLVRTKRGAILHMIELKPGHFFLEQNPLKPSKYGEAYRKIKQNFPEFYF 81 Query: 61 FWEIKDNKYTGRILAGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE 115 FWEIKDNKYTG++ AGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE Sbjct: 82 FWEIKDNKYTGKVFAGAFLEKEEIDEFLTLLAKTEDFKKLEHVLEEIEEIEEGEE 136 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.140 0.406 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45777986 Number of Sequences: 2977 Number of extensions: 1846901 Number of successful extensions: 5638 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5636 Number of HSP's gapped (non-prelim): 2 length of query: 115 length of database: 189,106,746 effective HSP length: 51 effective length of query: 64 effective length of database: 158,583,909 effective search space: 10149370176 effective search space used: 10149370176 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)