BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0440 602941 603495 185 !not a gene! (185 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71029 hypothetical protein PH1523 - Pyrococcus horikoshii ... 219 2e-56 >pir||A71029 hypothetical protein PH1523 - Pyrococcus horikoshii >gi|3257950|dbj|BAA30633.1| (AP000006) 236aa long hypothetical protein [Pyrococcus horikoshii] Length = 236 Score = 219 bits (551), Expect = 2e-56 Identities = 122/177 (68%), Positives = 137/177 (76%) Query: 9 EAFSRLSLDRNSLLSIATSMILRAVLLTTGSSSFKTSKAKLKASSIIFSFFVLVTISLRT 68 EAFSRLSL+R S LSIATS I A LTTG SSF TS+AKL ASS+I VL TIS T Sbjct: 13 EAFSRLSLERYSFLSIATSTIPSAAFLTTGFSSFNTSRAKLNASSMISGSLVLTTISFST 72 Query: 69 LNADTFFFVDFPCSMPLIQENIFLAIIIILAPSVATPSAAYSFIGSGLFSTIPMRTSESS 128 L A+TFFF DFP M LIQENI LA +IILAP VATPSAAYSFIGSGLFSTIP+ SES Sbjct: 73 LRAETFFFSDFPFRMFLIQENIILATLIILAPRVATPSAAYSFIGSGLFSTIPINISESL 132 Query: 129 ELRSSGRSMKLIIAFIVSTVCNTTLSSLSSRSLIKLGISSLISFVLNSFFIANFFMM 185 L SSG SMK+ +AFIVST C TT+SSLSS SLI+ GI+S S + +SFFIA+FF+M Sbjct: 133 VLISSGNSMKVTMAFIVSTACKTTVSSLSSNSLIRSGITSFTSSIPSSFFIASFFIM 189 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.136 0.358 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48954944 Number of Sequences: 2977 Number of extensions: 1589084 Number of successful extensions: 8284 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8282 Number of HSP's gapped (non-prelim): 1 length of query: 185 length of database: 189,106,746 effective HSP length: 60 effective length of query: 125 effective length of database: 153,197,526 effective search space: 19149690750 effective search space used: 19149690750 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 162 (67.5 bits)