BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0441 604317 604730 138 !not a gene! (138 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71028 hypothetical protein PH1521 - Pyrococcus horikoshii ... 122 2e-27 >pir||G71028 hypothetical protein PH1521 - Pyrococcus horikoshii >gi|3257948|dbj|BAA30631.1| (AP000006) 133aa long hypothetical protein [Pyrococcus horikoshii] Length = 133 Score = 122 bits (302), Expect = 2e-27 Identities = 74/128 (57%), Positives = 87/128 (67%) Query: 4 SGTSSLISLIVLGVSLSLFFEKIISREDIAFFFSSASCSVFMNSLISLVISSITSTLSLL 63 SGTS ISL V + S FF ++IS+++ AFF +S SCS+F SLIS I SIT LL Sbjct: 5 SGTSLWISLRVSELISSFFFVRMISKDERAFFLTSLSCSLFRTSLISFAIPSITFLSLLL 64 Query: 64 LAISVRALRAAPLTSLSFPSFIKETRNSTILFMKLVILAPKIPSSSAAYSLSIPLLEVII 123 LAISVRA++AA LTSLS S KETR FM +VI AP IPSSSAAYSL+IP L VI Sbjct: 65 LAISVRAVKAASLTSLSLLSLTKETRKFITFFMSVVIFAPMIPSSSAAYSLNIPFLVVIT 124 Query: 124 PDSVLITL 131 +V I L Sbjct: 125 FVNVAIIL 132 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.135 0.358 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38329286 Number of Sequences: 2977 Number of extensions: 1169665 Number of successful extensions: 5359 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5358 Number of HSP's gapped (non-prelim): 1 length of query: 138 length of database: 189,106,746 effective HSP length: 59 effective length of query: 79 effective length of database: 153,796,013 effective search space: 12149885027 effective search space used: 12149885027 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 160 (66.7 bits)