BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0453 622327 622725 133 !not a gene! (133 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71026 hypothetical protein PH1504 - Pyrococcus horikoshii ... 156 1e-37 >pir||D71026 hypothetical protein PH1504 - Pyrococcus horikoshii >gi|3257929|dbj|BAA30612.1| (AP000006) 107aa long hypothetical protein [Pyrococcus horikoshii] Length = 107 Score = 156 bits (390), Expect = 1e-37 Identities = 80/107 (74%), Positives = 88/107 (81%) Query: 27 VVKILSIYPDVPKPYLLDLHAAQPPPVPGINIPKANLHHRLSAIASSSNFFISSLLPTQR 86 +VK+ SI + KPY D H AQPPPVPGI PKANLHH SAIASSSNFFISS +PT R Sbjct: 1 MVKLFSINFNKTKPYFFDFHTAQPPPVPGIITPKANLHHCRSAIASSSNFFISSWVPTHR 60 Query: 87 TMVGSTVIIPSFIIGLITLTAFSMLCPLSTTSMTMGRSVDNLKTSLE 133 T+VGSTVIIPSFIIGLITLT FS+LCPLSTTS MGRSV++L TSLE Sbjct: 61 TIVGSTVIIPSFIIGLITLTTFSILCPLSTTSTIMGRSVESLITSLE 107 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.138 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48902839 Number of Sequences: 2977 Number of extensions: 2008280 Number of successful extensions: 4998 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4997 Number of HSP's gapped (non-prelim): 1 length of query: 133 length of database: 189,106,746 effective HSP length: 52 effective length of query: 81 effective length of database: 157,985,422 effective search space: 12796819182 effective search space used: 12796819182 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 161 (67.1 bits)