BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0455 623551 623898 116 !not a gene! (116 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71081 hypothetical protein PH0912 - Pyrococcus horikoshii ... 109 8e-24 >pir||B71081 hypothetical protein PH0912 - Pyrococcus horikoshii >gi|3257325|dbj|BAA30008.1| (AP000004) 105aa long hypothetical protein [Pyrococcus horikoshii] Length = 105 Score = 109 bits (271), Expect = 8e-24 Identities = 57/103 (55%), Positives = 70/103 (67%) Query: 14 VILIAIAIPIPETAIPTRKASRRVGTTPESLRSASVKLRASIMVPWIRAIKAPPMLLPIM 73 +IL A A P P A PT+KA VG TPE+ R A++KL A+I+ PWI A APP++LP M Sbjct: 3 LILRATATPKPAIATPTKKARMSVGITPETFRFATIKLNATIINPWIIATIAPPVILPRM 62 Query: 74 ASTLEAGATRSSFRNPNCLSQMSVIPCMKPMLKTVMATIPGTK 116 STL AGATR SF PNCLS + V PC K + TV+ T PGT+ Sbjct: 63 LSTLLAGATRISFMKPNCLSHIIVNPCKKLISNTVITTTPGTR 105 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.132 0.384 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37210903 Number of Sequences: 2977 Number of extensions: 1134820 Number of successful extensions: 5087 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5086 Number of HSP's gapped (non-prelim): 1 length of query: 116 length of database: 189,106,746 effective HSP length: 54 effective length of query: 62 effective length of database: 156,788,448 effective search space: 9720883776 effective search space used: 9720883776 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 160 (66.7 bits)