BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0456 625703 626233 177 !not a gene! (177 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A72741 hypothetical protein APE0458 - Aeropyrum pernix (str... 116 2e-25 >pir||A72741 hypothetical protein APE0458 - Aeropyrum pernix (strain K1) >gi|5104105|dbj|BAA79421.1| (AP000059) 160aa long hypothetical protein [Aeropyrum pernix] Length = 160 Score = 116 bits (288), Expect = 2e-25 Identities = 76/161 (47%), Positives = 92/161 (56%), Gaps = 1/161 (0%) Query: 17 IVSGGSILRTFPLKCVTINPSSKALSMTFWVSSMALSLVSLSLTSSTPIINPIPLTSPIS 76 +VSGG+IL +T P K LS T +S+ SLV SLTSSTPII+P+PLT P Sbjct: 1 MVSGGAILTAETPAPITRRPLLKDLSSTQARASLWGSLVFSSLTSSTPIISPLPLTWPTI 60 Query: 77 SCSSIIFLSLFMAWFPSFSALLNRFFSSISSITARAALEAVGLPESVKAWLSGGNESMIS 136 SS S+F A+ PS L + SI+SITA A A GLP V AWL G + S Sbjct: 61 LSSSAASPSIFSAFSPSLCDLSHSLSPSITSITALKAARATGLPPKVLAWLPRG-RLITS 119 Query: 137 LLPIVALIGNPPPRDLPTVIISGLTPKCSIANHFPVLPMPL 177 LLP A G+PPP L + SG TP+CS AN PVL P+ Sbjct: 120 LLPTAAPSGSPPPMALARAMTSGSTPQCSTANILPVLAKPV 160 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.131 0.381 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64187631 Number of Sequences: 2977 Number of extensions: 2353637 Number of successful extensions: 8180 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8178 Number of HSP's gapped (non-prelim): 1 length of query: 177 length of database: 189,106,746 effective HSP length: 56 effective length of query: 121 effective length of database: 155,591,474 effective search space: 18826568354 effective search space used: 18826568354 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 162 (67.5 bits)