BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0471 643885 644277 131 !not a gene! (131 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71022 hypothetical protein PH1476 - Pyrococcus horikoshii ... 191 3e-48 >pir||G71022 hypothetical protein PH1476 - Pyrococcus horikoshii >gi|3257900|dbj|BAA30583.1| (AP000006) 204aa long hypothetical protein [Pyrococcus horikoshii] Length = 204 Score = 191 bits (480), Expect = 3e-48 Identities = 102/131 (77%), Positives = 113/131 (85%) Query: 1 MLMATPLEIKAFMTFLTPSSLPSLIISASLITILALIKLSAAAYSLKYSPLSLWANFQSL 60 MLMATPL+I+A TFL PSS PSLIISAS ITI ALIKLS AAYSLKYSPLSL A+FQSL Sbjct: 38 MLMATPLDIRALTTFLIPSSCPSLIISASRITIFALIKLSEAAYSLKYSPLSLCASFQSL 97 Query: 61 TAVMLLITSPTPAAKYLLGAVFITSMSAITAIGGLAFIDVFASMPLIEAFALAIPSWEAV 120 TAV+LL SPTPAA+YL GAVFITS+SA+TAIGGLAFIDV PL++A ALAIPS +AV Sbjct: 98 TAVILLTISPTPAARYLFGAVFITSISAMTAIGGLAFIDVLTFKPLMDALALAIPSCDAV 157 Query: 121 VGKLMKGIPLL 131 VGKLM GIP+L Sbjct: 158 VGKLMNGIPIL 168 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.136 0.379 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40598546 Number of Sequences: 2977 Number of extensions: 1275443 Number of successful extensions: 5956 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5955 Number of HSP's gapped (non-prelim): 1 length of query: 131 length of database: 189,106,746 effective HSP length: 55 effective length of query: 76 effective length of database: 156,189,961 effective search space: 11870437036 effective search space used: 11870437036 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 160 (66.7 bits)