BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0473 (PAB0473) DE:Hypothetical protein (119 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75111 hypothetical protein PAB0473 - Pyrococcus abyssi (st... 243 4e-64 pir||D71022 hypothetical protein PH1473 - Pyrococcus horikoshii ... 233 6e-61 >pir||D75111 hypothetical protein PAB0473 - Pyrococcus abyssi (strain Orsay) >gi|5458116|emb|CAB49605.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 119 Score = 243 bits (615), Expect = 4e-64 Identities = 119/119 (100%), Positives = 119/119 (100%) Query: 1 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDNDSD 60 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDNDSD Sbjct: 1 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDNDSD 60 Query: 61 SLIFRLINNPDPKEIEGLLKRFEEIKEQEFRDDYERGYYTAWVELLQAYLSQSRLPVKR 119 SLIFRLINNPDPKEIEGLLKRFEEIKEQEFRDDYERGYYTAWVELLQAYLSQSRLPVKR Sbjct: 61 SLIFRLINNPDPKEIEGLLKRFEEIKEQEFRDDYERGYYTAWVELLQAYLSQSRLPVKR 119 >pir||D71022 hypothetical protein PH1473 - Pyrococcus horikoshii >gi|3257897|dbj|BAA30580.1| (AP000006) 119aa long hypothetical protein [Pyrococcus horikoshii] Length = 119 Score = 233 bits (588), Expect = 6e-61 Identities = 112/119 (94%), Positives = 117/119 (98%) Query: 1 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDNDSD 60 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDND+D Sbjct: 1 MPAREMRMEMFLRALLRRDFDKAKSHLEKLSKLVKDDEWGRGYLKAINGFMSAIKDNDND 60 Query: 61 SLIFRLINNPDPKEIEGLLKRFEEIKEQEFRDDYERGYYTAWVELLQAYLSQSRLPVKR 119 SLIFRL+N+PDPKEIE LL RFEE+KEQEFRDDYERGYYTAWVELLQAYLSQ+RLPVKR Sbjct: 61 SLIFRLLNDPDPKEIEELLNRFEEVKEQEFRDDYERGYYTAWVELLQAYLSQARLPVKR 119 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44092548 Number of Sequences: 2977 Number of extensions: 1704508 Number of successful extensions: 5629 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5627 Number of HSP's gapped (non-prelim): 2 length of query: 119 length of database: 189,106,746 effective HSP length: 52 effective length of query: 67 effective length of database: 157,985,422 effective search space: 10585023274 effective search space used: 10585023274 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)