BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0483 658518 658841 108 !not a gene! (108 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A72495 hypothetical protein APE2600 - Aeropyrum pernix (str... 89 1e-17 >pir||A72495 hypothetical protein APE2600 - Aeropyrum pernix (strain K1) >gi|5106306|dbj|BAA81617.1| (AP000064) 109aa long hypothetical protein [Aeropyrum pernix] Length = 109 Score = 89.3 bits (218), Expect = 1e-17 Identities = 48/91 (52%), Positives = 59/91 (64%), Gaps = 1/91 (1%) Query: 6 GIGYQSSLDITPFVCSSIFFMAPAIVILNLCLSFFGTLPTRDIGWKLTPLTMSRWFKPKF 65 G GYQ+S+ I P VCSSI F+ +VIL L LS F +P R GWKLTPLT S F Sbjct: 14 GTGYQASMGIWPSVCSSILFITSGMVILILSLSCFLIIPVRLTGWKLTPLTTSICFPANL 73 Query: 66 IIAPASWSLTFLMSVGTR-TIPGPPAFLTFS 95 II+P SWSL L++VGTR T+ PP++ S Sbjct: 74 IISPTSWSLIVLITVGTRTTLSRPPSWKALS 104 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.331 0.143 0.482 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43482680 Number of Sequences: 2977 Number of extensions: 1646184 Number of successful extensions: 3171 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3170 Number of HSP's gapped (non-prelim): 1 length of query: 108 length of database: 189,106,746 effective HSP length: 43 effective length of query: 65 effective length of database: 163,371,805 effective search space: 10619167325 effective search space used: 10619167325 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 160 (66.7 bits)