BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0497 671575 671874 100 !not a gene! (100 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71018 hypothetical protein PH1445 - Pyrococcus horikoshii ... 180 3e-45 >pir||H71018 hypothetical protein PH1445 - Pyrococcus horikoshii >gi|3257869|dbj|BAA30552.1| (AP000006) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 180 bits (453), Expect = 3e-45 Identities = 89/100 (89%), Positives = 97/100 (97%) Query: 1 MNSTPSFFSFSMFSLTIGCLYMLSCIAGAIIIGMCGKAVVTTVVTGVSSIPQAIFDIVLA 60 +NSTPSFF+FSMFSLT+GCLY+LSCIAGAIIIGMCGKAVVTTVVTGVSSIPQAIFDIV A Sbjct: 15 INSTPSFFNFSMFSLTMGCLYILSCIAGAIIIGMCGKAVVTTVVTGVSSIPQAIFDIVFA 74 Query: 61 VAGQTKIKSALFSCSPANSTCSMDPVISVITGFPVANSIA 100 VAGQT I+SALFSCSPA+STCS++PVISVITG PVANSIA Sbjct: 75 VAGQTSIRSALFSCSPASSTCSINPVISVITGLPVANSIA 114 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.135 0.393 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32347992 Number of Sequences: 2977 Number of extensions: 967947 Number of successful extensions: 3289 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3288 Number of HSP's gapped (non-prelim): 1 length of query: 100 length of database: 189,106,746 effective HSP length: 52 effective length of query: 48 effective length of database: 157,985,422 effective search space: 7583300256 effective search space used: 7583300256 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 159 (66.3 bits)