BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0503 (PAB0503) DE:Hypothetical protein (114 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75117 hypothetical protein PAB0503 - Pyrococcus abyssi (st... 227 3e-59 pir||E71015 hypothetical protein PH1419 - Pyrococcus horikoshii ... 145 2e-34 >pir||B75117 hypothetical protein PAB0503 - Pyrococcus abyssi (strain Orsay) >gi|5458162|emb|CAB49651.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 114 Score = 227 bits (572), Expect = 3e-59 Identities = 114/114 (100%), Positives = 114/114 (100%) Query: 1 MGMMEIWISDEEFEAIKRNKEKALEFLNNGDKLRTYLLSLKFKFLMEKLNNLEERLQEVE 60 MGMMEIWISDEEFEAIKRNKEKALEFLNNGDKLRTYLLSLKFKFLMEKLNNLEERLQEVE Sbjct: 1 MGMMEIWISDEEFEAIKRNKEKALEFLNNGDKLRTYLLSLKFKFLMEKLNNLEERLQEVE 60 Query: 61 QEYRKLKAFESRAFEDKEFLLRIRRELSIENSNLRRKLNNESNLSKKSICEDYS 114 QEYRKLKAFESRAFEDKEFLLRIRRELSIENSNLRRKLNNESNLSKKSICEDYS Sbjct: 61 QEYRKLKAFESRAFEDKEFLLRIRRELSIENSNLRRKLNNESNLSKKSICEDYS 114 >pir||E71015 hypothetical protein PH1419 - Pyrococcus horikoshii >gi|3257842|dbj|BAA30525.1| (AP000006) 114aa long hypothetical protein [Pyrococcus horikoshii] Length = 114 Score = 145 bits (361), Expect = 2e-34 Identities = 68/109 (62%), Positives = 87/109 (79%) Query: 1 MGMMEIWISDEEFEAIKRNKEKALEFLNNGDKLRTYLLSLKFKFLMEKLNNLEERLQEVE 60 MGMMEIW+ +EEF+AIKRN+EK L LN+ +K + YLLSLKFKFL EKLN LE+RL ++ Sbjct: 1 MGMMEIWVDEEEFKAIKRNREKGLTLLNDEEKFKLYLLSLKFKFLREKLNKLEKRLADIT 60 Query: 61 QEYRKLKAFESRAFEDKEFLLRIRRELSIENSNLRRKLNNESNLSKKSI 109 + Y KLK FE RA +DKEFL+ IR+ELS+ENSNLRR L +E N+ K+ + Sbjct: 61 ESYAKLKNFERRAVKDKEFLMEIRQELSLENSNLRRTLKDEGNVQKEQV 109 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.134 0.353 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37288345 Number of Sequences: 2977 Number of extensions: 1350807 Number of successful extensions: 10881 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10879 Number of HSP's gapped (non-prelim): 2 length of query: 114 length of database: 189,106,746 effective HSP length: 59 effective length of query: 55 effective length of database: 153,796,013 effective search space: 8458780715 effective search space used: 8458780715 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 159 (66.3 bits)