BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0551 772415 772810 132 !not a gene! (132 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71005 hypothetical protein PH1336 - Pyrococcus horikoshii ... 114 4e-25 >pir||B71005 hypothetical protein PH1336 - Pyrococcus horikoshii >gi|3257759|dbj|BAA30442.1| (AP000006) 138aa long hypothetical protein [Pyrococcus horikoshii] Length = 138 Score = 114 bits (283), Expect = 4e-25 Identities = 58/69 (84%), Positives = 59/69 (85%) Query: 1 MTIGRSLFIASLPRTGLAFTPFPPTMLSPISILLSWGMCFRYSRSPLEVFIAIASKSTRE 60 MTIGRSLFIASLPR G AFTPFPPTMLSP ILLS GMCFRYSRS EVFIA ASKSTRE Sbjct: 70 MTIGRSLFIASLPRRGFAFTPFPPTMLSPTRILLSGGMCFRYSRSLFEVFIAKASKSTRE 129 Query: 61 KMSAIFPPH 69 +SAIF PH Sbjct: 130 NISAIFVPH 138 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.136 0.430 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47293244 Number of Sequences: 2977 Number of extensions: 1734279 Number of successful extensions: 6247 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6246 Number of HSP's gapped (non-prelim): 1 length of query: 132 length of database: 189,106,746 effective HSP length: 49 effective length of query: 83 effective length of database: 159,780,883 effective search space: 13261813289 effective search space used: 13261813289 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 161 (67.1 bits)