BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0554 783088 783402 105 !not a gene! (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71003 hypothetical protein PH1324 - Pyrococcus horikoshii ... 178 1e-44 >pir||F71003 hypothetical protein PH1324 - Pyrococcus horikoshii >gi|3257747|dbj|BAA30430.1| (AP000006) 125aa long hypothetical protein [Pyrococcus horikoshii] Length = 125 Score = 178 bits (448), Expect = 1e-44 Identities = 92/105 (87%), Positives = 94/105 (88%) Query: 1 MILLIGSSLTFLFDCSFIWSFFKYLSQPSLGLNNINLLPLTSRSSLSVSSATFSAISFLP 60 +I LIGSSLTF F CSFIWSFFKY S PSLGLNNINLLPLTS+SSLSVSSAT SAISFL Sbjct: 21 LIFLIGSSLTFFFACSFIWSFFKYFSHPSLGLNNINLLPLTSKSSLSVSSATLSAISFLL 80 Query: 61 ILVDINAPFLISTFNTPVLASWVSISFITLSVIPFFPIHAFGSIS 105 ILV I APFLISTFNTPVLASWVSISFITLSVIPFFPI A GSIS Sbjct: 81 ILVAIKAPFLISTFNTPVLASWVSISFITLSVIPFFPIQALGSIS 125 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.140 0.420 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36076195 Number of Sequences: 2977 Number of extensions: 1173075 Number of successful extensions: 4371 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4370 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 49 effective length of query: 56 effective length of database: 159,780,883 effective search space: 8947729448 effective search space used: 8947729448 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 159 (66.3 bits)