BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0572 811885 812349 155 !not a gene! (155 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71073 hypothetical protein PH1276 - Pyrococcus horikoshii ... 153 7e-37 pir||H72731 hypothetical protein APE0393 - Aeropyrum pernix (str... 76 2e-13 >pir||A71073 hypothetical protein PH1276 - Pyrococcus horikoshii >gi|3257696|dbj|BAA30379.1| (AP000005) 109aa long hypothetical protein [Pyrococcus horikoshii] Length = 109 Score = 153 bits (384), Expect = 7e-37 Identities = 78/106 (73%), Positives = 87/106 (81%) Query: 50 INTSAPFRASSGPPSIPSSFVFSNSHPLYGKSFSRSRSLVRTIGFPFTSSTTLTFPGLTP 109 ++TSA RAS GPPS+ S FVF +SHPLYG +FS+SRSLVR +GFP TSSTTLTF GLTP Sbjct: 1 MSTSASLRASWGPPSMFSPFVFLSSHPLYGNNFSKSRSLVRILGFPLTSSTTLTFSGLTP 60 Query: 110 AFTSILSVANPAAPAPNKATLISSSLFPTTSRAFIRPARTTAAVPC 155 A SILSVANPAAPAPN A++IS FPTT RAF PARTTAAVPC Sbjct: 61 ASVSILSVANPAAPAPNNASVISLIFFPTTLRAFKSPARTTAAVPC 106 >pir||H72731 hypothetical protein APE0393 - Aeropyrum pernix (strain K1) >gi|5104032|dbj|BAA79348.1| (AP000059) 172aa long hypothetical protein [Aeropyrum pernix] Length = 172 Score = 76.1 bits (184), Expect = 2e-13 Identities = 58/117 (49%), Positives = 68/117 (57%), Gaps = 14/117 (11%) Query: 1 MATILAPAFLASSGNISGTGFANGKTIGSSLISLIHSGFITPGPGLVNDINTSAPFRAS- 59 +AT LAPA LAS G+ISG GFA+ T+GS + LIHS TPGPGL SAP RAS Sbjct: 62 VATTLAPASLASHGHISGVGFASANTMGSLDMPLIHSFLTTPGPGLEAATRASAPLRASS 121 Query: 60 ------SGPPSIPSSFVFSNSHPLYGKSFS-RSRSLVRTIGFPFTSSTTLTFPGLTP 109 S PPS+ S S + L +S S SRS RT P S+TT+ F GLTP Sbjct: 122 KLLPGASPPPSV--SRAISYLYLLEKRSLSISSRSGWRT---PLLSTTTM-FLGLTP 172 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.131 0.379 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59046306 Number of Sequences: 2977 Number of extensions: 2505093 Number of successful extensions: 9042 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9040 Number of HSP's gapped (non-prelim): 2 length of query: 155 length of database: 189,106,746 effective HSP length: 56 effective length of query: 99 effective length of database: 155,591,474 effective search space: 15403555926 effective search space used: 15403555926 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)