BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0583 831274 831606 111 !not a gene! (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C72700 hypothetical protein APE1018 - Aeropyrum pernix (str... 80 6e-15 >pir||C72700 hypothetical protein APE1018 - Aeropyrum pernix (strain K1) >gi|5104688|dbj|BAA80003.1| (AP000060) 104aa long hypothetical protein [Aeropyrum pernix] Length = 104 Score = 80.4 bits (195), Expect = 6e-15 Identities = 43/93 (46%), Positives = 54/93 (57%) Query: 7 SAPFSSIASMKFSTLPLLLLIFCPSRVPKPLTAIPLGQCSSLNIATWLNMKNVKWFGIRS 66 SAP S A ++ LPL LLIF P+ +P T + LG S N+A W NMK +WFG+RS Sbjct: 3 SAPHQSRACLRRMKLPLDLLIFSPATRTQPFTPMALGHSSLGNMAVWWNMKKTRWFGMRS 62 Query: 67 FPEHLQSSGYQYSNSSFISWIISAGIPVFFSSS 99 P L S GYQY NS IS G+P+ +S Sbjct: 63 LPLILMSRGYQYRNSLLISSSSPWGMPLLLDTS 95 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.131 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39350066 Number of Sequences: 2977 Number of extensions: 1426353 Number of successful extensions: 3550 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3549 Number of HSP's gapped (non-prelim): 1 length of query: 111 length of database: 189,106,746 effective HSP length: 52 effective length of query: 59 effective length of database: 157,985,422 effective search space: 9321139898 effective search space used: 9321139898 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)