BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0584 832252 832557 102 !not a gene! (102 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71088 hypothetical protein PH0967 - Pyrococcus horikoshii ... 145 1e-34 >pir||B71088 hypothetical protein PH0967 - Pyrococcus horikoshii >gi|3257381|dbj|BAA30064.1| (AP000004) 113aa long hypothetical protein [Pyrococcus horikoshii] Length = 113 Score = 145 bits (362), Expect = 1e-34 Identities = 72/80 (90%), Positives = 75/80 (93%) Query: 1 MSYLTSISDSLFRSSRATWSKGAWAGTLITTPVALSGSTNSAGSIITSSPVTGFLTYFPI 60 MSY +SIS SLF+SSRATWS GAWAGTLITTPVALSGSTNSAG IITSSP+TGFLTYFPI Sbjct: 34 MSYFSSISVSLFKSSRATWSNGAWAGTLITTPVALSGSTNSAGKIITSSPLTGFLTYFPI 93 Query: 61 SFSPLNSSITSISLSWNESL 80 SFSPLNSSITSISLSW ESL Sbjct: 94 SFSPLNSSITSISLSWKESL 113 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.126 0.362 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35455270 Number of Sequences: 2977 Number of extensions: 1232093 Number of successful extensions: 4483 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4482 Number of HSP's gapped (non-prelim): 1 length of query: 102 length of database: 189,106,746 effective HSP length: 57 effective length of query: 45 effective length of database: 154,992,987 effective search space: 6974684415 effective search space used: 6974684415 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 158 (66.0 bits)