BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0619 (PAB0619) DE:Hypothetical protein (100 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75140 hypothetical protein PAB0619 - Pyrococcus abyssi (st... 196 5e-50 pir||A71100 hypothetical protein PH1061 - Pyrococcus horikoshii ... 155 1e-37 >pir||E75140 hypothetical protein PAB0619 - Pyrococcus abyssi (strain Orsay) >gi|5458349|emb|CAB49838.1| (AJ248285) hypothetical protein [Pyrococcus abyssi] Length = 100 Score = 196 bits (493), Expect = 5e-50 Identities = 100/100 (100%), Positives = 100/100 (100%) Query: 1 MEELKQLMKSHILGNPVRLGIMVFLLSRRKATFSQIQKVLDLTPGNLKSHLNVLEKDKLI 60 MEELKQLMKSHILGNPVRLGIMVFLLSRRKATFSQIQKVLDLTPGNLKSHLNVLEKDKLI Sbjct: 1 MEELKQLMKSHILGNPVRLGIMVFLLSRRKATFSQIQKVLDLTPGNLKSHLNVLEKDKLI 60 Query: 61 KTYKVIADRPRTVVEITDKGIQETRKFLKMLKGIIDSIEF 100 KTYKVIADRPRTVVEITDKGIQETRKFLKMLKGIIDSIEF Sbjct: 61 KTYKVIADRPRTVVEITDKGIQETRKFLKMLKGIIDSIEF 100 >pir||A71100 hypothetical protein PH1061 - Pyrococcus horikoshii >gi|3257476|dbj|BAA30159.1| (AP000004) 100aa long hypothetical protein [Pyrococcus horikoshii] Length = 100 Score = 155 bits (388), Expect = 1e-37 Identities = 74/99 (74%), Positives = 88/99 (88%) Query: 1 MEELKQLMKSHILGNPVRLGIMVFLLSRRKATFSQIQKVLDLTPGNLKSHLNVLEKDKLI 60 MEELK++MKSHILGNPVRLGIM+FLL RRKA FSQIQKVLDLTPGNL SH+ VLE++ L+ Sbjct: 1 MEELKEIMKSHILGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLV 60 Query: 61 KTYKVIADRPRTVVEITDKGIQETRKFLKMLKGIIDSIE 99 KTYKVIADRPRTVVEITD G++E ++FL LK +ID ++ Sbjct: 61 KTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGLD 99 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.140 0.376 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31992072 Number of Sequences: 2977 Number of extensions: 1064015 Number of successful extensions: 3388 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3386 Number of HSP's gapped (non-prelim): 2 length of query: 100 length of database: 189,106,746 effective HSP length: 55 effective length of query: 45 effective length of database: 156,189,961 effective search space: 7028548245 effective search space used: 7028548245 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 158 (66.0 bits)