BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0637 911066 911626 187 !not a gene! (187 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71076 hypothetical protein PH0877 - Pyrococcus horikoshii ... 122 4e-27 >pir||E71076 hypothetical protein PH0877 - Pyrococcus horikoshii >gi|3257288|dbj|BAA29971.1| (AP000004) 128aa long hypothetical protein [Pyrococcus horikoshii] Length = 128 Score = 122 bits (302), Expect = 4e-27 Identities = 75/131 (57%), Positives = 87/131 (66%), Gaps = 6/131 (4%) Query: 18 VASPLIASPPAKTPGIEVIKFSSTIILPFSSTFN--SGTVWRNVLFGVCPIAIIAVSNSM 75 +ASPLIASPPAKTPGIEVI+FSST I+P + S + +LFG P+AII VS S Sbjct: 1 MASPLIASPPAKTPGIEVIRFSSTTIVPSGLVLSLPSSVI---ILFGSSPMAIITVSASN 57 Query: 76 TNVSPVGIGLLLPVSSGSPS-FIFSSSIALRFPFSSPMNLFGETRNMNLTPSSSACLISS 134 SPV L P+ S S S F+ S+ AL PFSSPMN G +N N TPSSSAC ISS Sbjct: 58 VTYSPVPTIFLFPLLSRSSSGFVLSNLTALTLPFSSPMNSTGCRKNSNFTPSSSACFISS 117 Query: 135 SLAVISFLVLL 145 SLAV+S L LL Sbjct: 118 SLAVMSSLPLL 128 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.135 0.392 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64470964 Number of Sequences: 2977 Number of extensions: 2527704 Number of successful extensions: 6852 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6850 Number of HSP's gapped (non-prelim): 1 length of query: 187 length of database: 189,106,746 effective HSP length: 55 effective length of query: 132 effective length of database: 156,189,961 effective search space: 20617074852 effective search space used: 20617074852 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 162 (67.5 bits)