BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0649 (PAB0649) DE:Hypothetical protein (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75071 hypothetical protein PAB0649 - Pyrococcus abyssi (st... 198 9e-51 pir||C71094 hypothetical protein PH1016 - Pyrococcus horikoshii ... 111 2e-24 >pir||E75071 hypothetical protein PAB0649 - Pyrococcus abyssi (strain Orsay) >gi|5458386|emb|CAB49874.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 103 Score = 198 bits (499), Expect = 9e-51 Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MKEIIIVVPRKRFKELKNVNIAELIQRNLEKAEITLEAEYINYLLEKRARLLEKLSDMEG 60 MKEIIIVVPRKRFKELKNVNIAELIQRNLEKAEITLEAEYINYLLEKRARLLEKLSDMEG Sbjct: 1 MKEIIIVVPRKRFKELKNVNIAELIQRNLEKAEITLEAEYINYLLEKRARLLEKLSDMEG 60 Query: 61 KIEELRSYYNKVLQDNLLMKSERERLNKENSTLRRELKSKVNS 103 KIEELRSYYNKVLQDNLLMKSERERLNKENSTLRRELKSKVNS Sbjct: 61 KIEELRSYYNKVLQDNLLMKSERERLNKENSTLRRELKSKVNS 103 >pir||C71094 hypothetical protein PH1016 - Pyrococcus horikoshii >gi|3257430|dbj|BAA30113.1| (AP000004) 115aa long hypothetical protein [Pyrococcus horikoshii] Length = 115 Score = 111 bits (274), Expect = 2e-24 Identities = 55/97 (56%), Positives = 72/97 (73%) Query: 2 KEIIIVVPRKRFKELKNVNIAELIQRNLEKAEITLEAEYINYLLEKRARLLEKLSDMEGK 61 +EI I+VPR +FKELK +I +LI NL+ TL AEY YLLEKR +L+EKL++ME K Sbjct: 15 EEITIIVPRDKFKELKRSDIKKLITDNLDNVRETLIAEYEEYLLEKREKLIEKLNEMESK 74 Query: 62 IEELRSYYNKVLQDNLLMKSERERLNKENSTLRRELK 98 I ELR YY K L+DN ++K+ERERL +EN L++ LK Sbjct: 75 IAELRKYYEKALKDNEILKTERERLKRENEELKKMLK 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.132 0.329 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30886643 Number of Sequences: 2977 Number of extensions: 1098260 Number of successful extensions: 7608 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7606 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 189,106,746 effective HSP length: 62 effective length of query: 41 effective length of database: 152,000,552 effective search space: 6232022632 effective search space used: 6232022632 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 158 (66.0 bits)