BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0673 (PAB0673) DE:Hypothetical protein (129 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75076 hypothetical protein PAB0673 - Pyrococcus abyssi (st... 269 1e-71 pir||B71068 hypothetical protein PH1240 - Pyrococcus horikoshii ... 222 2e-57 gi|11498460 A. fulgidus predicted coding region AF0854 [Archaeog... 116 8e-26 >pir||F75076 hypothetical protein PAB0673 - Pyrococcus abyssi (strain Orsay) >gi|5458427|emb|CAB49915.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 129 Score = 269 bits (680), Expect = 1e-71 Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MDVRELLIEQYGYAPDDLVLEVRGKRIYAYKPCELKEEGHEGIYIGAIEKDGIRLTIEGA 60 MDVRELLIEQYGYAPDDLVLEVRGKRIYAYKPCELKEEGHEGIYIGAIEKDGIRLTIEGA Sbjct: 1 MDVRELLIEQYGYAPDDLVLEVRGKRIYAYKPCELKEEGHEGIYIGAIEKDGIRLTIEGA 60 Query: 61 FIIGPKAEKNVIELDDEKARAWMSGKDVEVGVKGNAWVILKWRNFWLGGGKLVDGVVKNY 120 FIIGPKAEKNVIELDDEKARAWMSGKDVEVGVKGNAWVILKWRNFWLGGGKLVDGVVKNY Sbjct: 61 FIIGPKAEKNVIELDDEKARAWMSGKDVEVGVKGNAWVILKWRNFWLGGGKLVDGVVKNY 120 Query: 121 VPKERRLVL 129 VPKERRLVL Sbjct: 121 VPKERRLVL 129 >pir||B71068 hypothetical protein PH1240 - Pyrococcus horikoshii >gi|3257657|dbj|BAA30340.1| (AP000005) 129aa long hypothetical protein [Pyrococcus horikoshii] Length = 129 Score = 222 bits (559), Expect = 2e-57 Identities = 97/127 (76%), Positives = 117/127 (91%) Query: 1 MDVRELLIEQYGYAPDDLVLEVRGKRIYAYKPCELKEEGHEGIYIGAIEKDGIRLTIEGA 60 MD+RE+LIEQYGYAP+ L+LEV+GK+IYAYKPC+ E GH GIYIGAIEKDGIRLTIEG+ Sbjct: 1 MDIREMLIEQYGYAPEGLILEVKGKKIYAYKPCDFPENGHNGIYIGAIEKDGIRLTIEGS 60 Query: 61 FIIGPKAEKNVIELDDEKARAWMSGKDVEVGVKGNAWVILKWRNFWLGGGKLVDGVVKNY 120 FIIGP A++NVIE+DDE+A++WM G+D+EV +GN WVILKWR+FWLGGGKLV+GVVKNY Sbjct: 61 FIIGPNAKRNVIEVDDERAKSWMRGEDIEVNEEGNRWVILKWRDFWLGGGKLVNGVVKNY 120 Query: 121 VPKERRL 127 +PKERRL Sbjct: 121 IPKERRL 127 >gi|11498460 A. fulgidus predicted coding region AF0854 [Archaeoglobus fulgidus] >gi|7483498|pir||F69356 hypothetical protein AF0854 - Archaeoglobus fulgidus >gi|2649759|gb|AAB90395.1| (AE001045) A. fulgidus predicted coding region AF0854 [Archaeoglobus fulgidus] Length = 128 Score = 116 bits (289), Expect = 8e-26 Identities = 63/129 (48%), Positives = 88/129 (67%), Gaps = 5/129 (3%) Query: 3 VRELLIEQY-GYAPDDLVLEVRGK-RIYAYKPCELKE-EGHEGIYIGAIEKDGIRLTIEG 59 +R LL EQ+ P+D+ + GK R+YAYK CE E H GIY G IE+DG+RL+IEG Sbjct: 1 MRRLLKEQFEAELPEDIRFYMGGKSRVYAYKSCEFDEIASHRGIYFGTIERDGLRLSIEG 60 Query: 60 AFIIGPKAEKNVIELDDEKARAWMSGKDVEVGVKGNAWVILKWRNFWLGGGKLVDGVVKN 119 +FI G A+KNVIELD+E WM G+D+E VKG + I+K +++ G GK V++N Sbjct: 61 SFIAGKLAKKNVIELDEESFGRWMRGEDIEADVKG--YCIVKHGSYFAGCGKGNGRVLRN 118 Query: 120 YVPKERRLV 128 +VPK+RR++ Sbjct: 119 FVPKDRRVI 127 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.144 0.438 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54714275 Number of Sequences: 2977 Number of extensions: 2322647 Number of successful extensions: 3962 Number of sequences better than 1.0e-10: 3 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3957 Number of HSP's gapped (non-prelim): 3 length of query: 129 length of database: 189,106,746 effective HSP length: 48 effective length of query: 81 effective length of database: 160,379,370 effective search space: 12990728970 effective search space used: 12990728970 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)