BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0683 (PAB0683) DE:Hypothetical protein (135 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75078 hypothetical protein PAB0683 - Pyrococcus abyssi (st... 309 9e-84 >pir||E75078 hypothetical protein PAB0683 - Pyrococcus abyssi (strain Orsay) >gi|5458442|emb|CAB49930.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 135 Score = 309 bits (784), Expect = 9e-84 Identities = 135/135 (100%), Positives = 135/135 (100%) Query: 1 MNWSLWILLGLRCRSADDALYCILNLGSWGHSIEFYPSCLNCAHGVRSNLGGNYCVYALI 60 MNWSLWILLGLRCRSADDALYCILNLGSWGHSIEFYPSCLNCAHGVRSNLGGNYCVYALI Sbjct: 1 MNWSLWILLGLRCRSADDALYCILNLGSWGHSIEFYPSCLNCAHGVRSNLGGNYCVYALI 60 Query: 61 YEHLHSHWTGSTCRCRGWILNYPNVFNLSIFNIHYSKRWSSCEYRSNGVFQSSTISWNRD 120 YEHLHSHWTGSTCRCRGWILNYPNVFNLSIFNIHYSKRWSSCEYRSNGVFQSSTISWNRD Sbjct: 61 YEHLHSHWTGSTCRCRGWILNYPNVFNLSIFNIHYSKRWSSCEYRSNGVFQSSTISWNRD 120 Query: 121 PHTHHLRILCICTDI 135 PHTHHLRILCICTDI Sbjct: 121 PHTHHLRILCICTDI 135 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.328 0.140 0.518 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62257986 Number of Sequences: 2977 Number of extensions: 2532334 Number of successful extensions: 5363 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5362 Number of HSP's gapped (non-prelim): 1 length of query: 135 length of database: 189,106,746 effective HSP length: 41 effective length of query: 94 effective length of database: 164,568,779 effective search space: 15469465226 effective search space used: 15469465226 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)