BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0686 (PAB0686) DE:Hypothetical protein (112 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75079 hypothetical protein PAB0686 - Pyrococcus abyssi (st... 238 2e-62 pir||C71066 hypothetical protein PH1225 - Pyrococcus horikoshii ... 107 5e-23 >pir||F75079 hypothetical protein PAB0686 - Pyrococcus abyssi (strain Orsay) >gi|5458451|emb|CAB49939.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 112 Score = 238 bits (600), Expect = 2e-62 Identities = 112/112 (100%), Positives = 112/112 (100%) Query: 1 MNFLGIVPKVARISIPYAILSLILNYLFNINLSFPYGILLTFPGILAWIYCYLQVSKAYK 60 MNFLGIVPKVARISIPYAILSLILNYLFNINLSFPYGILLTFPGILAWIYCYLQVSKAYK Sbjct: 1 MNFLGIVPKVARISIPYAILSLILNYLFNINLSFPYGILLTFPGILAWIYCYLQVSKAYK 60 Query: 61 RGILMKEGCYSIVRHPIYSIWGCFMDSDKRNFFVLLFSIIFKYFYGIFMLVW 112 RGILMKEGCYSIVRHPIYSIWGCFMDSDKRNFFVLLFSIIFKYFYGIFMLVW Sbjct: 61 RGILMKEGCYSIVRHPIYSIWGCFMDSDKRNFFVLLFSIIFKYFYGIFMLVW 112 >pir||C71066 hypothetical protein PH1225 - Pyrococcus horikoshii >gi|3257642|dbj|BAA30325.1| (AP000005) 173aa long hypothetical protein [Pyrococcus horikoshii] Length = 173 Score = 107 bits (265), Expect = 5e-23 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 1/83 (1%) Query: 1 MNFLGIVPKVARISIPYAILSLILNYLFNINLSFP-YGILLTFPGILAWIYCYLQVSKAY 59 +NFLGIVPKVA++S Y S +L LF + SFP G +L F GI+ W CY QVSKAY Sbjct: 19 LNFLGIVPKVAKVSFLYIAFSALLERLFTFDFSFPRIGGILVFVGIVLWAICYFQVSKAY 78 Query: 60 KRGILMKEGCYSIVRHPIYSIWG 82 K G L+K GCYS+VRHPIY+IWG Sbjct: 79 KAGKLLKSGCYSVVRHPIYTIWG 101 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.337 0.153 0.510 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42508845 Number of Sequences: 2977 Number of extensions: 1632940 Number of successful extensions: 5575 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5572 Number of HSP's gapped (non-prelim): 2 length of query: 112 length of database: 189,106,746 effective HSP length: 41 effective length of query: 71 effective length of database: 164,568,779 effective search space: 11684383309 effective search space used: 11684383309 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 39 (21.6 bits) S2: 160 (66.7 bits)