BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0710 (PAB0710) DE:Hypothetical protein (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75084 hypothetical protein PAB0710 - Pyrococcus abyssi (st... 213 6e-55 pir||E71063 hypothetical protein PH1203 - Pyrococcus horikoshii ... 171 3e-42 >pir||E75084 hypothetical protein PAB0710 - Pyrococcus abyssi (strain Orsay) >gi|5458490|emb|CAB49978.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 111 Score = 213 bits (536), Expect = 6e-55 Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MITSGTLRSSLMFLAPTKNITFLISSAYPFIILITPSTSPLAAGLNTGSAIPTIEAPMAK 60 MITSGTLRSSLMFLAPTKNITFLISSAYPFIILITPSTSPLAAGLNTGSAIPTIEAPMAK Sbjct: 1 MITSGTLRSSLMFLAPTKNITFLISSAYPFIILITPSTSPLAAGLNTGSAIPTIEAPMAK 60 Query: 61 AFAIVIPSLIPPLAIMGKLVAHLTSAKLIAVLIPQSQNFKAKLRFSPSFVL 111 AFAIVIPSLIPPLAIMGKLVAHLTSAKLIAVLIPQSQNFKAKLRFSPSFVL Sbjct: 61 AFAIVIPSLIPPLAIMGKLVAHLTSAKLIAVLIPQSQNFKAKLRFSPSFVL 111 >pir||E71063 hypothetical protein PH1203 - Pyrococcus horikoshii >gi|3257620|dbj|BAA30303.1| (AP000005) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 171 bits (428), Expect = 3e-42 Identities = 89/111 (80%), Positives = 96/111 (86%) Query: 1 MITSGTLRSSLMFLAPTKNITFLISSAYPFIILITPSTSPLAAGLNTGSAIPTIEAPMAK 60 M+T GTLR+SL+FLAPT+NITF ISSAYP IIL TPSTSPLAAGLNTG AIPT EAP+A Sbjct: 1 MMTRGTLRNSLIFLAPTRNITFFISSAYPLIILTTPSTSPLAAGLNTGRAIPTKEAPIAN 60 Query: 61 AFAIVIPSLIPPLAIMGKLVAHLTSAKLIAVLIPQSQNFKAKLRFSPSFVL 111 A AI+ PSLIPPLAI+GKLVAHLTSAKLIAVLIPQSQNF A FS SF L Sbjct: 61 ALAIITPSLIPPLAIIGKLVAHLTSAKLIAVLIPQSQNFNAIFLFSLSFAL 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.136 0.375 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35092802 Number of Sequences: 2977 Number of extensions: 1187042 Number of successful extensions: 4003 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4001 Number of HSP's gapped (non-prelim): 2 length of query: 111 length of database: 189,106,746 effective HSP length: 55 effective length of query: 56 effective length of database: 156,189,961 effective search space: 8746637816 effective search space used: 8746637816 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 159 (66.3 bits)