BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0726 (PAB0726) DE:Hypothetical protein (182 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75088 hypothetical protein PAB0726 - Pyrococcus abyssi (st... 358 3e-98 pir||F71056 hypothetical protein PH1148 - Pyrococcus horikoshii ... 249 2e-65 >pir||D75088 hypothetical protein PAB0726 - Pyrococcus abyssi (strain Orsay) >gi|5458521|emb|CAB50009.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 182 Score = 358 bits (908), Expect = 3e-98 Identities = 182/182 (100%), Positives = 182/182 (100%) Query: 1 MRRIKVPYIIFKTKSGIYGIDAYTSLRVEKVERAATLIRRFDKMPSMIKMEETELALISK 60 MRRIKVPYIIFKTKSGIYGIDAYTSLRVEKVERAATLIRRFDKMPSMIKMEETELALISK Sbjct: 1 MRRIKVPYIIFKTKSGIYGIDAYTSLRVEKVERAATLIRRFDKMPSMIKMEETELALISK 60 Query: 61 DNVGDFLIRLKDYTKNKAASKLNQRFKKMRRWNLFRFLGIPTGHSRHISEEERLAKENRE 120 DNVGDFLIRLKDYTKNKAASKLNQRFKKMRRWNLFRFLGIPTGHSRHISEEERLAKENRE Sbjct: 61 DNVGDFLIRLKDYTKNKAASKLNQRFKKMRRWNLFRFLGIPTGHSRHISEEERLAKENRE 120 Query: 121 ALLALSILNVVLKGDVEPLGYSFIELEIRDDGVYIDGKKDGVYTELLKVDMRAAIALLEL 180 ALLALSILNVVLKGDVEPLGYSFIELEIRDDGVYIDGKKDGVYTELLKVDMRAAIALLEL Sbjct: 121 ALLALSILNVVLKGDVEPLGYSFIELEIRDDGVYIDGKKDGVYTELLKVDMRAAIALLEL 180 Query: 181 AR 182 AR Sbjct: 181 AR 182 >pir||F71056 hypothetical protein PH1148 - Pyrococcus horikoshii >gi|3257565|dbj|BAA30248.1| (AP000005) 180aa long hypothetical protein [Pyrococcus horikoshii] Length = 180 Score = 249 bits (628), Expect = 2e-65 Identities = 123/182 (67%), Positives = 151/182 (82%), Gaps = 2/182 (1%) Query: 1 MRRIKVPYIIFKTKSGIYGIDAYTSLRVEKVERAATLIRRFDKMPSMIKMEETELALISK 60 M+ I++PYIIF+TKSG+YGIDAYT+LRVEK ER ATLIR+F++MP + E E ALI K Sbjct: 1 MKEIELPYIIFRTKSGLYGIDAYTALRVEKPERVATLIRKFNRMPEVT--ENHEFALIKK 58 Query: 61 DNVGDFLIRLKDYTKNKAASKLNQRFKKMRRWNLFRFLGIPTGHSRHISEEERLAKENRE 120 + V +FL + Y K KA+SK+ +R KMRRW LFR LGIPTGHSRHISEEERLAKENRE Sbjct: 59 NEVEEFLYSVLKYAKEKASSKMKERVSKMRRWGLFRLLGIPTGHSRHISEEERLAKENRE 118 Query: 121 ALLALSILNVVLKGDVEPLGYSFIELEIRDDGVYIDGKKDGVYTELLKVDMRAAIALLEL 180 ALLALSIL +LKG++E LGYS I +E+R+DG+Y++G+ D VYTEL+KVDMRAA+ALLEL Sbjct: 119 ALLALSILETILKGNLEVLGYSSINVEVREDGIYVNGELDRVYTELIKVDMRAAMALLEL 178 Query: 181 AR 182 AR Sbjct: 179 AR 180 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.140 0.385 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58586364 Number of Sequences: 2977 Number of extensions: 2228252 Number of successful extensions: 8973 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8970 Number of HSP's gapped (non-prelim): 2 length of query: 182 length of database: 189,106,746 effective HSP length: 56 effective length of query: 126 effective length of database: 155,591,474 effective search space: 19604525724 effective search space used: 19604525724 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 162 (67.5 bits)