BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0734 1059227 1059547 107 !not a gene! (107 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71053 hypothetical protein PH1125 - Pyrococcus horikoshii ... 157 3e-38 >pir||F71053 hypothetical protein PH1125 - Pyrococcus horikoshii >gi|3257541|dbj|BAA30224.1| (AP000005) 113aa long hypothetical protein [Pyrococcus horikoshii] Length = 113 Score = 157 bits (393), Expect = 3e-38 Identities = 85/107 (79%), Positives = 92/107 (85%) Query: 1 MDSSLNPISIRVFLILSTLLLIFLSNFSLSFMLSSKAFLIASPTLSISPSQIPTSFIPEL 60 MDSSLNPIS+RVFLILSTL LIFL + SLSF+LSS+A L+ASPT ISPS P SFIPEL Sbjct: 7 MDSSLNPISVRVFLILSTLFLIFLKSLSLSFILSSRALLMASPTSLISPSHTPISFIPEL 66 Query: 61 VDLTSSLISLVLNSDKSSILSSPRRRISNSILTSLPKVAPLNFTGIT 107 V L SSLISLVLNS+ SSILSSPRR ISNS T+LPKVAPLNFTGIT Sbjct: 67 VALISSLISLVLNSEISSILSSPRRSISNSSFTNLPKVAPLNFTGIT 113 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.134 0.348 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31778085 Number of Sequences: 2977 Number of extensions: 1039990 Number of successful extensions: 4296 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4295 Number of HSP's gapped (non-prelim): 1 length of query: 107 length of database: 189,106,746 effective HSP length: 59 effective length of query: 48 effective length of database: 153,796,013 effective search space: 7382208624 effective search space used: 7382208624 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)