BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0786 (PAB0786) DE:Hypothetical protein (133 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75098 hypothetical protein PAB0786 - Pyrococcus abyssi (st... 265 2e-70 gi|11497915 A. fulgidus predicted coding region AF0300 [Archaeog... 71 5e-12 >pir||D75098 hypothetical protein PAB0786 - Pyrococcus abyssi (strain Orsay) >gi|5458601|emb|CAB50089.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 133 Score = 265 bits (669), Expect = 2e-70 Identities = 133/133 (100%), Positives = 133/133 (100%) Query: 1 MYLVDTNVFLEIFLNQEKANEAEEFLTKTPTEYSHISDFSLYSIGIILSRQKKYAVFSDF 60 MYLVDTNVFLEIFLNQEKANEAEEFLTKTPTEYSHISDFSLYSIGIILSRQKKYAVFSDF Sbjct: 1 MYLVDTNVFLEIFLNQEKANEAEEFLTKTPTEYSHISDFSLYSIGIILSRQKKYAVFSDF 60 Query: 61 VEDVLLEGGVTLLRLSPFDLGSVINAAERFNLDFDDAYQYTLARKYNLKIVSFDSDFDKT 120 VEDVLLEGGVTLLRLSPFDLGSVINAAERFNLDFDDAYQYTLARKYNLKIVSFDSDFDKT Sbjct: 61 VEDVLLEGGVTLLRLSPFDLGSVINAAERFNLDFDDAYQYTLARKYNLKIVSFDSDFDKT 120 Query: 121 DIGRLLPAQALRR 133 DIGRLLPAQALRR Sbjct: 121 DIGRLLPAQALRR 133 >gi|11497915 A. fulgidus predicted coding region AF0300 [Archaeoglobus fulgidus] >gi|7483402|pir||D69287 hypothetical protein AF0300 - Archaeoglobus fulgidus >gi|2650343|gb|AAB90942.1| (AE001084) A. fulgidus predicted coding region AF0300 [Archaeoglobus fulgidus] Length = 50 Score = 71.0 bits (171), Expect = 5e-12 Identities = 30/45 (66%), Positives = 39/45 (86%) Query: 87 AERFNLDFDDAYQYTLARKYNLKIVSFDSDFDKTDIGRLLPAQAL 131 ++++ LDFDDAYQY LA+KYNL+IVSF+SDFD+TD GR LP Q + Sbjct: 2 SKKYKLDFDDAYQYALAKKYNLEIVSFNSDFDRTDAGRALPEQVI 46 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.140 0.387 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46258375 Number of Sequences: 2977 Number of extensions: 1744376 Number of successful extensions: 3864 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3862 Number of HSP's gapped (non-prelim): 2 length of query: 133 length of database: 189,106,746 effective HSP length: 54 effective length of query: 79 effective length of database: 156,788,448 effective search space: 12386287392 effective search space used: 12386287392 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 161 (67.1 bits)