BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0804 (PAB0804) DE:Hypothetical protein (151 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75101 hypothetical protein PAB0804 - Pyrococcus abyssi (st... 288 2e-77 pir||B71085 hypothetical protein PH0943 - Pyrococcus horikoshii ... 196 9e-50 >pir||G75101 hypothetical protein PAB0804 - Pyrococcus abyssi (strain Orsay) >gi|5458628|emb|CAB50116.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 151 Score = 288 bits (730), Expect = 2e-77 Identities = 151/151 (100%), Positives = 151/151 (100%) Query: 1 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIV 60 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIV Sbjct: 1 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIV 60 Query: 61 IGLFIFAYEKVREEGIELPLGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEIL 120 IGLFIFAYEKVREEGIELPLGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEIL Sbjct: 61 IGLFIFAYEKVREEGIELPLGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEIL 120 Query: 121 AGWRLYDSVGEALILFSAALGFSLLIRGKKK 151 AGWRLYDSVGEALILFSAALGFSLLIRGKKK Sbjct: 121 AGWRLYDSVGEALILFSAALGFSLLIRGKKK 151 >pir||B71085 hypothetical protein PH0943 - Pyrococcus horikoshii >gi|3257357|dbj|BAA30040.1| (AP000004) 162aa long hypothetical protein [Pyrococcus horikoshii] Length = 162 Score = 196 bits (494), Expect = 9e-50 Identities = 100/152 (65%), Positives = 122/152 (79%), Gaps = 1/152 (0%) Query: 1 MLGTMLSFMIILLALTVVLHRDFLASLIAYSLVGLSFVMLAVLARAPDVALSAIAVGGIV 60 MLG +L +++ LAL V+LHRDF+ SLI YSL L F++L +L+ APDVALS I VGGIV Sbjct: 1 MLGIILEVVMLTLALIVILHRDFMTSLIVYSLTSLVFILLVLLSYAPDVALSGIVVGGIV 60 Query: 61 IGLFIFAYEKVREE-GIELPLGLAVVPLAIALLRLRVSVNPGSYYHYIKAWSIGNLVSEI 119 GLF+F YE+ E ++LPLGLAV+PLA ALLR++ VN SY Y+KAW+I NLVSEI Sbjct: 61 TGLFVFGYERAGGECKVKLPLGLAVLPLAFALLRVKFKVNLASYEAYVKAWNINNLVSEI 120 Query: 120 LAGWRLYDSVGEALILFSAALGFSLLIRGKKK 151 LAGWRLYDSVGEALILFSAALGFSLL+ G+K+ Sbjct: 121 LAGWRLYDSVGEALILFSAALGFSLLMGGRKR 152 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.145 0.413 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48261762 Number of Sequences: 2977 Number of extensions: 1806353 Number of successful extensions: 9008 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9005 Number of HSP's gapped (non-prelim): 2 length of query: 151 length of database: 189,106,746 effective HSP length: 52 effective length of query: 99 effective length of database: 157,985,422 effective search space: 15640556778 effective search space used: 15640556778 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 161 (67.1 bits)