BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0828 (PAB0828) DE:Hypothetical protein (238 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75033 hypothetical protein PAB0828 - Pyrococcus abyssi (st... 507 e-143 >pir||B75033 hypothetical protein PAB0828 - Pyrococcus abyssi (strain Orsay) >gi|5458672|emb|CAB50159.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 238 Score = 507 bits (1291), Expect = e-143 Identities = 238/238 (100%), Positives = 238/238 (100%) Query: 1 MNWVIVILTFDVEPDCPPFLWSERGLKEGLPRILELLDKHEVPGTFFFTAKWAERYQELV 60 MNWVIVILTFDVEPDCPPFLWSERGLKEGLPRILELLDKHEVPGTFFFTAKWAERYQELV Sbjct: 1 MNWVIVILTFDVEPDCPPFLWSERGLKEGLPRILELLDKHEVPGTFFFTAKWAERYQELV 60 Query: 61 DEIRERHELGCHGYAHERFDKLSLKEAESVIEKAKKVLGDVKSFRAPNLKLPLEYYKILK 120 DEIRERHELGCHGYAHERFDKLSLKEAESVIEKAKKVLGDVKSFRAPNLKLPLEYYKILK Sbjct: 61 DEIRERHELGCHGYAHERFDKLSLKEAESVIEKAKKVLGDVKSFRAPNLKLPLEYYKILK 120 Query: 121 DNGFLVDSSKALHKGWKGIREVNGVLEVPVYTTSLVTRLPWRIQLRWHKKNNRVKVLMFH 180 DNGFLVDSSKALHKGWKGIREVNGVLEVPVYTTSLVTRLPWRIQLRWHKKNNRVKVLMFH Sbjct: 121 DNGFLVDSSKALHKGWKGIREVNGVLEVPVYTTSLVTRLPWRIQLRWHKKNNRVKVLMFH 180 Query: 181 PWEFVKMPINHRPDCWFGTGKKALDLLDKIIGFYKSQGAEFLTLVDFYHIYVKNKDLY 238 PWEFVKMPINHRPDCWFGTGKKALDLLDKIIGFYKSQGAEFLTLVDFYHIYVKNKDLY Sbjct: 181 PWEFVKMPINHRPDCWFGTGKKALDLLDKIIGFYKSQGAEFLTLVDFYHIYVKNKDLY 238 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.143 0.457 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98145095 Number of Sequences: 2977 Number of extensions: 4210886 Number of successful extensions: 9849 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9848 Number of HSP's gapped (non-prelim): 1 length of query: 238 length of database: 189,106,746 effective HSP length: 48 effective length of query: 190 effective length of database: 160,379,370 effective search space: 30472080300 effective search space used: 30472080300 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 164 (68.3 bits)