BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0831 (PAB0831) DE:Hypothetical protein (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75033 hypothetical protein PAB0831 - Pyrococcus abyssi (st... 218 1e-56 pir||F71135 hypothetical protein PH0850 - Pyrococcus horikoshii ... 155 1e-37 >pir||E75033 hypothetical protein PAB0831 - Pyrococcus abyssi (strain Orsay) >gi|5458675|emb|CAB50162.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 111 Score = 218 bits (550), Expect = 1e-56 Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MLEILSFMFFTGGGLVMLYIAAFASTNLIRIAALLGALGYGMLGFLVAESMSLDIRRKSR 60 MLEILSFMFFTGGGLVMLYIAAFASTNLIRIAALLGALGYGMLGFLVAESMSLDIRRKSR Sbjct: 1 MLEILSFMFFTGGGLVMLYIAAFASTNLIRIAALLGALGYGMLGFLVAESMSLDIRRKSR 60 Query: 61 RSDRNVILAITLISFGLNYYALYAYTHSNVAPILLMGPGLVIGLWTYAKAK 111 RSDRNVILAITLISFGLNYYALYAYTHSNVAPILLMGPGLVIGLWTYAKAK Sbjct: 61 RSDRNVILAITLISFGLNYYALYAYTHSNVAPILLMGPGLVIGLWTYAKAK 111 >pir||F71135 hypothetical protein PH0850 - Pyrococcus horikoshii >gi|3257261|dbj|BAA29944.1| (AP000003) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 155 bits (388), Expect = 1e-37 Identities = 75/111 (67%), Positives = 92/111 (82%) Query: 1 MLEILSFMFFTGGGLVMLYIAAFASTNLIRIAALLGALGYGMLGFLVAESMSLDIRRKSR 60 MLEI SFMFFTGGGLVML+IAAF+ T RIAA+LGA+GYG+LGFLV ESMS+DIRRK + Sbjct: 1 MLEIFSFMFFTGGGLVMLFIAAFSITWAQRIAAILGAIGYGLLGFLVVESMSMDIRRKRK 60 Query: 61 RSDRNVILAITLISFGLNYYALYAYTHSNVAPILLMGPGLVIGLWTYAKAK 111 +D+N+IL +TL SF LNYYAL +Y VAP+LL+GPGL++GLW + K K Sbjct: 61 AADKNIILGMTLGSFALNYYALASYLRDYVAPLLLVGPGLLLGLWIFLKGK 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.144 0.416 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37126016 Number of Sequences: 2977 Number of extensions: 1243165 Number of successful extensions: 4621 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4619 Number of HSP's gapped (non-prelim): 2 length of query: 111 length of database: 189,106,746 effective HSP length: 50 effective length of query: 61 effective length of database: 159,182,396 effective search space: 9710126156 effective search space used: 9710126156 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 160 (66.7 bits)