BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0847 (PAB0847) DE:Hypothetical protein (134 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B75037 hypothetical protein PAB0847 - Pyrococcus abyssi (st... 263 6e-70 pir||C71126 hypothetical protein PH0777 - Pyrococcus horikoshii ... 115 2e-25 >pir||B75037 hypothetical protein PAB0847 - Pyrococcus abyssi (strain Orsay) >gi|5458704|emb|CAB50191.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 134 Score = 263 bits (665), Expect = 6e-70 Identities = 134/134 (100%), Positives = 134/134 (100%) Query: 1 MRIKAKDAIPVLIAILALALGSYIARWILALIVAGILFAYSLEGWEPKLPNLNIRRERND 60 MRIKAKDAIPVLIAILALALGSYIARWILALIVAGILFAYSLEGWEPKLPNLNIRRERND Sbjct: 1 MRIKAKDAIPVLIAILALALGSYIARWILALIVAGILFAYSLEGWEPKLPNLNIRRERND 60 Query: 61 EVRRLSLIIKRTEFSETSRKIVIEHLKEAYRMIGINVNENPPKAIKLLQDDPSNFSRLDE 120 EVRRLSLIIKRTEFSETSRKIVIEHLKEAYRMIGINVNENPPKAIKLLQDDPSNFSRLDE Sbjct: 61 EVRRLSLIIKRTEFSETSRKIVIEHLKEAYRMIGINVNENPPKAIKLLQDDPSNFSRLDE 120 Query: 121 ILRMVEEDINERSG 134 ILRMVEEDINERSG Sbjct: 121 ILRMVEEDINERSG 134 >pir||C71126 hypothetical protein PH0777 - Pyrococcus horikoshii >gi|3257186|dbj|BAA29869.1| (AP000003) 135aa long hypothetical protein [Pyrococcus horikoshii] Length = 135 Score = 115 bits (285), Expect = 2e-25 Identities = 57/131 (43%), Positives = 85/131 (64%), Gaps = 6/131 (4%) Query: 3 IKAKDAIPVLIAILALALGSYIARWILALIVAGILFAYSLEGWEPKLPNLNIRRERNDEV 62 +++K IP++ A+ A+ +Y+ RWI AL+ A ILFAYSLEGWEPKLPN++ R DE+ Sbjct: 1 MRSKYIIPLIFALGAVLFRNYLVRWISALLTAMILFAYSLEGWEPKLPNISFRTSMKDEI 60 Query: 63 RRLSLIIKRTEFSETSRKIVIEHLKEAYRMIGINVNENPPKAIKLLQDDPSNFSRLDEIL 122 RL+ I+KR S SRKI++EH+++ Y ++G+ E+ + + + L+ IL Sbjct: 61 ERLARIVKRANTSPISRKIILEHVRDIYNILGLEFREDE------FRWEGDSIRDLERIL 114 Query: 123 RMVEEDINERS 133 VEEDIN RS Sbjct: 115 TKVEEDINGRS 125 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.140 0.390 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46372811 Number of Sequences: 2977 Number of extensions: 1691563 Number of successful extensions: 9142 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9139 Number of HSP's gapped (non-prelim): 2 length of query: 134 length of database: 189,106,746 effective HSP length: 54 effective length of query: 80 effective length of database: 156,788,448 effective search space: 12543075840 effective search space used: 12543075840 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)