BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0864 1265820 1266134 105 !not a gene! (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G72711 hypothetical protein APE1110 - Aeropyrum pernix (str... 89 1e-17 >pir||G72711 hypothetical protein APE1110 - Aeropyrum pernix (strain K1) >gi|5104780|dbj|BAA80095.1| (AP000060) 161aa long hypothetical protein [Aeropyrum pernix] Length = 161 Score = 88.9 bits (217), Expect = 1e-17 Identities = 45/72 (62%), Positives = 48/72 (66%) Query: 32 QPNATALGGPSNLVGVAYLSGTGISGPLCEPLIQPLTKCGNANGSRTSPSAGRPLWALTI 91 +P A LGGPSNL TGI GP PLIQP T+CG A GS TSP+AG PL ALTI Sbjct: 9 KPRAMTLGGPSNLETFESFRPTGIRGPWWLPLIQPATRCGKAKGSSTSPTAGNPLCALTI 68 Query: 92 ATGSSFPTYSPA 103 TGSS PTY PA Sbjct: 69 ITGSSLPTYLPA 80 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.130 0.396 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44480446 Number of Sequences: 2977 Number of extensions: 1955409 Number of successful extensions: 3238 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3237 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 52 effective length of query: 53 effective length of database: 157,985,422 effective search space: 8373227366 effective search space used: 8373227366 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 159 (66.3 bits)