BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0887 (PAB0887) DE:Hypothetical protein (144 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75044 hypothetical protein PAB0887 - Pyrococcus abyssi (st... 300 4e-81 pir||C75188 hypothetical protein PAB0019 - Pyrococcus abyssi (st... 92 4e-18 >pir||F75044 hypothetical protein PAB0887 - Pyrococcus abyssi (strain Orsay) >gi|5458764|emb|CAB50251.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 144 Score = 300 bits (761), Expect = 4e-81 Identities = 144/144 (100%), Positives = 144/144 (100%) Query: 1 MSLCFLFAASTLWEVFRMDMGGMKKVLNELENGRSWVAVTVKTREGPTKVLETFEKYLKD 60 MSLCFLFAASTLWEVFRMDMGGMKKVLNELENGRSWVAVTVKTREGPTKVLETFEKYLKD Sbjct: 1 MSLCFLFAASTLWEVFRMDMGGMKKVLNELENGRSWVAVTVKTREGPTKVLETFEKYLKD 60 Query: 61 NGWKPQFKANWWSSNAFGVAMFEAEKGKEHRVVLVKWVVTEKEEVMNVESKDDREGRTEF 120 NGWKPQFKANWWSSNAFGVAMFEAEKGKEHRVVLVKWVVTEKEEVMNVESKDDREGRTEF Sbjct: 61 NGWKPQFKANWWSSNAFGVAMFEAEKGKEHRVVLVKWVVTEKEEVMNVESKDDREGRTEF 120 Query: 121 YALVDMISDDLIFDSVLRHMMSRY 144 YALVDMISDDLIFDSVLRHMMSRY Sbjct: 121 YALVDMISDDLIFDSVLRHMMSRY 144 >pir||C75188 hypothetical protein PAB0019 - Pyrococcus abyssi (strain Orsay) >gi|5457463|emb|CAB48954.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 126 Score = 91.7 bits (224), Expect = 4e-18 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 1/110 (0%) Query: 36 WVAVTVKTREGPTKVLETFEKYLKDNGWKPQFKANWWSSNA-FGVAMFEAEKGKEHRVVL 94 W+ +T KT GP +E E+ +K+ GW+ FKANWW+++ +G+ +A K +++L Sbjct: 17 WLILTFKTPYGPLDTMEIIERAVKEAGWEVTFKANWWTADIPYGLVRIDARKNGREKIIL 76 Query: 95 VKWVVTEKEEVMNVESKDDREGRTEFYALVDMISDDLIFDSVLRHMMSRY 144 +W++ + EV+ VE+ D +G+ EF+ VD I+ LI D V+R M +Y Sbjct: 77 GRWILGKNLEVIKVENLDLEKGKEEFFRTVDSITSTLIHDPVIRTMREQY 126 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.134 0.409 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53407314 Number of Sequences: 2977 Number of extensions: 2031586 Number of successful extensions: 5187 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5185 Number of HSP's gapped (non-prelim): 2 length of query: 144 length of database: 189,106,746 effective HSP length: 52 effective length of query: 92 effective length of database: 157,985,422 effective search space: 14534658824 effective search space used: 14534658824 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)