BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0902 1317365 1317862 166 !not a gene! (166 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71196 hypothetical protein PH1841 - Pyrococcus horikoshii ... 189 1e-47 pir||C72479 hypothetical protein APE2475 - Aeropyrum pernix (str... 149 2e-35 pir||H72504 hypothetical protein APE2014 - Aeropyrum pernix (str... 90 1e-17 >pir||C71196 hypothetical protein PH1841 - Pyrococcus horikoshii >gi|3258279|dbj|BAA30962.1| (AP000007) 141aa long hypothetical protein [Pyrococcus horikoshii] Length = 141 Score = 189 bits (476), Expect = 1e-47 Identities = 104/133 (78%), Positives = 109/133 (81%) Query: 34 NLSSFSSSFKALITVSFSKSGSIGIPLVCIWRISFLPCLSGTPTSISLSNLPGLLKAGSS 93 N SF S + L T SF KSGSIGIPLV I ISFLPCLSGTPTSISLS PGLLKAGS Sbjct: 9 NFPSFLSPSRILSTSSFLKSGSIGIPLVWICSISFLPCLSGTPTSISLSKRPGLLKAGSK 68 Query: 94 ASGLLVAAITITLPLLLRPSIRVNSWLTTLFSTSPTTSSLFGAIASISSMKIIAGAFSSA 153 ASGLLVA ITITLPL +PSI+ +SW TTLFSTSP TS LFGAIASISS+KII GAFSSA Sbjct: 69 ASGLLVAPITITLPLPFKPSIKASSWATTLFSTSPVTSLLFGAIASISSIKIIDGAFSSA 128 Query: 154 SLNISLNLSSLSP 166 SLN SLNLSSLSP Sbjct: 129 SLNTSLNLSSLSP 141 >pir||C72479 hypothetical protein APE2475 - Aeropyrum pernix (strain K1) >gi|5106180|dbj|BAA81491.1| (AP000064) 353aa long hypothetical protein [Aeropyrum pernix] Length = 353 Score = 149 bits (372), Expect = 2e-35 Identities = 89/142 (62%), Positives = 103/142 (71%), Gaps = 2/142 (1%) Query: 27 FLIFSLSNLSSFSSSFKALITVSFSKSGSI--GIPLVCIWRISFLPCLSGTPTSISLSNL 84 ++ SL+ + + +I+ SFS+S S GI LVCI IS LPCLSG TSISLSNL Sbjct: 212 YMAASLARAARSAPVKPLVISASFSRSMSSARGICLVCICSISSLPCLSGKGTSISLSNL 271 Query: 85 PGLLKAGSSASGLLVAAITITLPLLLRPSIRVNSWLTTLFSTSPTTSSLFGAIASISSMK 144 PGLL+AGS A GLLVAA+TITLPL PS+R S TTL STSPTTSSLFGA+ASISSMK Sbjct: 272 PGLLRAGSMALGLLVAAMTITLPLASSPSMRARSCATTLLSTSPTTSSLFGAMASISSMK 331 Query: 145 IIAGAFSSASLNISLNLSSLSP 166 I+ GAF AS ISL+ SLSP Sbjct: 332 IMLGAFFLASSKISLSRCSLSP 353 >pir||H72504 hypothetical protein APE2014 - Aeropyrum pernix (strain K1) >gi|5105712|dbj|BAA81024.1| (AP000063) 280aa long hypothetical protein [Aeropyrum pernix] Length = 280 Score = 90.1 bits (220), Expect = 1e-17 Identities = 65/126 (51%), Positives = 73/126 (57%), Gaps = 3/126 (2%) Query: 44 ALITVSFSKSGSIGIPLVCIWRISFLPCLSGTPTSISLSNLPGLLKAGSSASGLLVAAIT 103 +L S S SG+I LV + IS LP G TSI LSNLPGL AGS S LLVAA+T Sbjct: 2 SLAIASRSTSGAIFAFLVWMPSISSLPRRLGRGTSIILSNLPGLRTAGSMRSSLLVAAMT 61 Query: 104 ITLPLLLRPSIRVNSW---LTTLFSTSPTTSSLFGAIASISSMKIIAGAFSSASLNISLN 160 TL +PS SW L T S S+L A+ASISSM I GAFS ASLNISL Sbjct: 62 FTLSRGSKPSSSARSWSMVLCTSLSPLVPMSTLLDAMASISSMNSIEGAFSLASLNISLT 121 Query: 161 LSSLSP 166 + SP Sbjct: 122 SLAPSP 127 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.132 0.360 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51125699 Number of Sequences: 2977 Number of extensions: 1984496 Number of successful extensions: 10060 Number of sequences better than 1.0e-10: 3 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10055 Number of HSP's gapped (non-prelim): 4 length of query: 166 length of database: 189,106,746 effective HSP length: 59 effective length of query: 107 effective length of database: 153,796,013 effective search space: 16456173391 effective search space used: 16456173391 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 162 (67.5 bits)