BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0920 1344922 1345530 203 !not a gene! (203 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71110 hypothetical protein PH0651 - Pyrococcus horikoshii ... 158 4e-38 >pir||D71110 hypothetical protein PH0651 - Pyrococcus horikoshii >gi|3257059|dbj|BAA29742.1| (AP000003) 102aa long hypothetical protein [Pyrococcus horikoshii] Length = 102 Score = 158 bits (396), Expect = 4e-38 Identities = 80/100 (80%), Positives = 87/100 (87%) Query: 66 ITRSLGGMNIAREFKVVVLPEPVPPATRILAGLTPSPSTSNHKKAATSELNVLNLIRSII 125 IT SLGGMNIA+EF VVVLPEPVPPATR+ AGLTP PST + + AATSE VLN I+SII Sbjct: 3 ITLSLGGMNIAKEFNVVVLPEPVPPATRMFAGLTPRPSTRSQRNAATSEFKVLNFIKSII 62 Query: 126 VNGSFLNFLIVNVGPSKLIGGKVALTLLPSGSLASRRGFC 165 V+GSFLNFLIV VGPS+LIGG VALTLLPSGSLASR GFC Sbjct: 63 VSGSFLNFLIVIVGPSRLIGGNVALTLLPSGSLASRSGFC 102 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.135 0.385 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69532228 Number of Sequences: 2977 Number of extensions: 2699829 Number of successful extensions: 8193 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8192 Number of HSP's gapped (non-prelim): 1 length of query: 203 length of database: 189,106,746 effective HSP length: 56 effective length of query: 147 effective length of database: 155,591,474 effective search space: 22871946678 effective search space used: 22871946678 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 163 (67.9 bits)