BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0935 1364517 1364918 134 !not a gene! (134 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71171 hypothetical protein PH0571 - Pyrococcus horikoshii ... 129 2e-29 >pir||G71171 hypothetical protein PH0571 - Pyrococcus horikoshii >gi|3256977|dbj|BAA29660.1| (AP000002) 181aa long hypothetical protein [Pyrococcus horikoshii] Length = 181 Score = 129 bits (320), Expect = 2e-29 Identities = 74/100 (74%), Positives = 83/100 (83%) Query: 35 MYFMFRVQSASIMLLAIASFIVPLVPSSTSSLSLDIPKLSLYSSVTLAIFAIILTASIGN 94 M F+ VQ AS++LL IASFIVPL S +S L IPKLSLYSSVT AI AII TASIGN Sbjct: 1 MNFIPIVQMASMILLVIASFIVPLFVPSRNSRILVIPKLSLYSSVTFAILAIISTASIGN 60 Query: 95 FPIAVSSESMTASVPSSIALATSVTSALVGTFSAVIETNI 134 FP AVSS+++TASVPSSIALATSVTSALVGTFS V+ET+I Sbjct: 61 FPTAVSSDNITASVPSSIALATSVTSALVGTFSIVMETSI 100 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.132 0.343 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34906504 Number of Sequences: 2977 Number of extensions: 1012009 Number of successful extensions: 4466 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4465 Number of HSP's gapped (non-prelim): 1 length of query: 134 length of database: 189,106,746 effective HSP length: 61 effective length of query: 73 effective length of database: 152,599,039 effective search space: 11139729847 effective search space used: 11139729847 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 160 (66.7 bits)