BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0994 1461757 1462293 179 !not a gene! (179 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71059 hypothetical protein PH1168 - Pyrococcus horikoshii ... 88 6e-17 >pir||B71059 hypothetical protein PH1168 - Pyrococcus horikoshii >gi|3257585|dbj|BAA30268.1| (AP000005) 118aa long hypothetical protein [Pyrococcus horikoshii] Length = 118 Score = 88.2 bits (215), Expect = 6e-17 Identities = 51/111 (45%), Positives = 67/111 (59%) Query: 1 MMTYKSFNLLVFTILTVKLTDSPGPITFGSKLETLRPGTLNVTLRISTVSLKGFKMVYMS 60 ++ YK F+L+VF +TVKLT G I+ GSK L PGTL +T IST S KGF++VY+S Sbjct: 4 LIMYKLFSLVVFVRVTVKLTTPLGGISRGSKSTILSPGTLKLTFTISTASSKGFEIVYIS 63 Query: 61 LGTEGSGPIKAPIWESILSPLSSAGFIISNSILPRGTFLRELPCQTSRYAL 111 LGT P KA + I++ SS + NSI+P G F L Q + Y L Sbjct: 64 LGTNELEPTKASTYAGIVNVFSSEASKMLNSIIPIGIFFVMLFLQITTYVL 114 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.139 0.398 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61261887 Number of Sequences: 2977 Number of extensions: 2267041 Number of successful extensions: 4265 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4264 Number of HSP's gapped (non-prelim): 1 length of query: 179 length of database: 189,106,746 effective HSP length: 54 effective length of query: 125 effective length of database: 156,788,448 effective search space: 19598556000 effective search space used: 19598556000 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 162 (67.5 bits)