BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1015 1494669 1494968 100 !not a gene! (100 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71163 hypothetical protein PH0508 - Pyrococcus horikoshii ... 68 2e-11 >pir||G71163 hypothetical protein PH0508 - Pyrococcus horikoshii >gi|3256913|dbj|BAA29596.1| (AP000002) 136aa long hypothetical protein [Pyrococcus horikoshii] Length = 136 Score = 68.3 bits (164), Expect = 2e-11 Identities = 33/81 (40%), Positives = 54/81 (65%) Query: 12 LPQDLPGIQTYALQSPPNELILFDIGNVLQERSKDKVKDPINLIEGIKRGEGILKNSLNV 71 LPQ+L IQT LQ+P ++ N Q+ K+++K+PINL++G+K E ILK+ LN+ Sbjct: 4 LPQNLTRIQTNTLQTPLDQFFPLPRSNTPQKIPKNQIKNPINLMQGVKTSERILKDGLNI 63 Query: 72 FIVVVHQLIFIEAPDVLSLKE 92 I++ QL I+ P++L+ K+ Sbjct: 64 LIIIPPQLFPIKTPNILTPKQ 84 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.143 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35861038 Number of Sequences: 2977 Number of extensions: 1241830 Number of successful extensions: 2541 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2540 Number of HSP's gapped (non-prelim): 1 length of query: 100 length of database: 189,106,746 effective HSP length: 51 effective length of query: 49 effective length of database: 158,583,909 effective search space: 7770611541 effective search space used: 7770611541 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)