BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1023 1510318 1510755 146 !not a gene! (146 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71161 hypothetical protein PH0489 - Pyrococcus horikoshii ... 166 1e-40 >pir||D71161 hypothetical protein PH0489 - Pyrococcus horikoshii >gi|3256894|dbj|BAA29577.1| (AP000002) 120aa long hypothetical protein [Pyrococcus horikoshii] Length = 120 Score = 166 bits (416), Expect = 1e-40 Identities = 84/120 (70%), Positives = 94/120 (78%) Query: 20 MSYNDSAGFGGLNETGSPIKLDSMSVYADISMFPTSMIADLPISSNSSMLPGSMPIRTAE 79 MSY DSAGFGGL ETGSP K + MSVY +I MFPTS+IAD PISS+S MLPGSMP T Sbjct: 1 MSYRDSAGFGGLKETGSPSKFERMSVYTEIRMFPTSIIADFPISSSSVMLPGSMPRSTEL 60 Query: 80 MLRALCFGNWSIVKPERPSVTSNMTVKPFETPLSARSFKNSALETISTSGASISIGPPII 139 MLRALC GN IV P+ PSV SN+TV P +TPLSA +NS +TISTSGASIS+GPPII Sbjct: 61 MLRALCLGNCRIVSPDIPSVMSNITVNPLDTPLSASILRNSTRDTISTSGASISMGPPII 120 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.314 0.129 0.363 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51802023 Number of Sequences: 2977 Number of extensions: 1884659 Number of successful extensions: 4748 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4747 Number of HSP's gapped (non-prelim): 1 length of query: 146 length of database: 189,106,746 effective HSP length: 58 effective length of query: 88 effective length of database: 154,394,500 effective search space: 13586716000 effective search space used: 13586716000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 161 (67.1 bits)