BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1024 1511923 1512252 110 !not a gene! (110 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71161 hypothetical protein PH0486 - Pyrococcus horikoshii ... 167 4e-41 >pir||A71161 hypothetical protein PH0486 - Pyrococcus horikoshii >gi|3256891|dbj|BAA29574.1| (AP000002) 170aa long hypothetical protein [Pyrococcus horikoshii] Length = 170 Score = 167 bits (418), Expect = 4e-41 Identities = 85/101 (84%), Positives = 88/101 (86%) Query: 2 TTSLTTSIPTPLPETSVTFSAVLNPGRKIRFIASSSLKLAASSGVINPLSMAFFLTFSGS 61 TTS TTSIPTPLP+TSVT SAVLNPGR I+ IASSSL+ AASSGVI PLS AF TFSGS Sbjct: 70 TTSFTTSIPTPLPDTSVTLSAVLNPGRNIKLIASSSLRFAASSGVIRPLSTAFLFTFSGS 129 Query: 62 IPLPSSLTIITTWFFSLLAISSTLPTLGFPSLTLSSGGSIP 102 IPLPSSLTIITTWFFSL AISSTLP LG PS TLSSGGSIP Sbjct: 130 IPLPSSLTIITTWFFSLFAISSTLPALGLPSFTLSSGGSIP 170 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.131 0.374 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38124660 Number of Sequences: 2977 Number of extensions: 1335895 Number of successful extensions: 4620 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4619 Number of HSP's gapped (non-prelim): 1 length of query: 110 length of database: 189,106,746 effective HSP length: 55 effective length of query: 55 effective length of database: 156,189,961 effective search space: 8590447855 effective search space used: 8590447855 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)