BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1096 (PAB1096) DE:Hypothetical protein (151 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75017 hypothetical protein PAB1096 - Pyrococcus abyssi (st... 300 4e-81 pir||D71455 hypothetical protein PH0298 - Pyrococcus horikoshii ... 221 3e-57 >pir||A75017 hypothetical protein PAB1096 - Pyrococcus abyssi (strain Orsay) >gi|5459089|emb|CAB50575.1| (AJ248288) hypothetical protein [Pyrococcus abyssi] Length = 151 Score = 300 bits (761), Expect = 4e-81 Identities = 151/151 (100%), Positives = 151/151 (100%) Query: 1 MDKKIASLAVVLVVVLVVAVRTAEIPPATIVGSAEIFMVNNTTATIVEKDGWGLFTLTVK 60 MDKKIASLAVVLVVVLVVAVRTAEIPPATIVGSAEIFMVNNTTATIVEKDGWGLFTLTVK Sbjct: 1 MDKKIASLAVVLVVVLVVAVRTAEIPPATIVGSAEIFMVNNTTATIVEKDGWGLFTLTVK 60 Query: 61 PKITGFTLRLEFPQGTTYLIKINGKEIKGKDVFETKISQDSEIIVSFQLPKEDTRKLYSG 120 PKITGFTLRLEFPQGTTYLIKINGKEIKGKDVFETKISQDSEIIVSFQLPKEDTRKLYSG Sbjct: 61 PKITGFTLRLEFPQGTTYLIKINGKEIKGKDVFETKISQDSEIIVSFQLPKEDTRKLYSG 120 Query: 121 EGQYYIKVKASKMPFWNSEYVIYLLPREKKD 151 EGQYYIKVKASKMPFWNSEYVIYLLPREKKD Sbjct: 121 EGQYYIKVKASKMPFWNSEYVIYLLPREKKD 151 >pir||D71455 hypothetical protein PH0298 - Pyrococcus horikoshii >gi|3256688|dbj|BAA29371.1| (AP000001) 154aa long hypothetical protein [Pyrococcus horikoshii] Length = 154 Score = 221 bits (557), Expect = 3e-57 Identities = 100/150 (66%), Positives = 129/150 (85%) Query: 1 MDKKIASLAVVLVVVLVVAVRTAEIPPATIVGSAEIFMVNNTTATIVEKDGWGLFTLTVK 60 MDKKI +LAV+LV VLV A++TA IPPA + GSAEIF++NN T TIVEKDGWGLFTLT+K Sbjct: 4 MDKKIVTLAVILVAVLVYAMKTASIPPAYVEGSAEIFLMNNKTVTIVEKDGWGLFTLTIK 63 Query: 61 PKITGFTLRLEFPQGTTYLIKINGKEIKGKDVFETKISQDSEIIVSFQLPKEDTRKLYSG 120 PKI+ FTL +EFP+GT YLIK NGKE++G++ F TKIS ++E+IV+FQLPK+ T +LY Sbjct: 64 PKISDFTLEIEFPEGTKYLIKKNGKELRGENTFSTKISGNTELIVNFQLPKDKTERLYRE 123 Query: 121 EGQYYIKVKASKMPFWNSEYVIYLLPREKK 150 EG+YYIK+K +K+PFWN+EY IYL+PR++K Sbjct: 124 EGEYYIKIKTTKLPFWNAEYTIYLIPRKEK 153 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.137 0.383 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52036005 Number of Sequences: 2977 Number of extensions: 2028791 Number of successful extensions: 5487 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5485 Number of HSP's gapped (non-prelim): 2 length of query: 151 length of database: 189,106,746 effective HSP length: 55 effective length of query: 96 effective length of database: 156,189,961 effective search space: 14994236256 effective search space used: 14994236256 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)