BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1133 1703177 1703626 150 !not a gene! (150 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71076 hypothetical protein PH0877 - Pyrococcus horikoshii ... 182 1e-45 >pir||E71076 hypothetical protein PH0877 - Pyrococcus horikoshii >gi|3257288|dbj|BAA29971.1| (AP000004) 128aa long hypothetical protein [Pyrococcus horikoshii] Length = 128 Score = 182 bits (458), Expect = 1e-45 Identities = 101/130 (77%), Positives = 106/130 (80%), Gaps = 3/130 (2%) Query: 22 VASPLIASPPAKTPGIEVIKFSSTIIVPSSLTLS-PGVVLHSILFGVCPIAIITVSASTV 80 +ASPLIASPPAKTPGIEVI+FSST IVPS L LS P V+ ILFG P+AIITVSAS V Sbjct: 1 MASPLIASPPAKTPGIEVIRFSSTTIVPSGLVLSLPSSVI--ILFGSSPMAIITVSASNV 58 Query: 81 MYSPVPTIFLFPLLSRSSKGFIFSNLTALTLPSSSPMNSTGFTKNMNLTPSSFACCTSSI 140 YSPVPTIFLFPLLSRSS GF+ SNLTALTLP SSPMNSTG KN N TPSS AC SS Sbjct: 59 TYSPVPTIFLFPLLSRSSSGFVLSNLTALTLPFSSPMNSTGCRKNSNFTPSSSACFISSS 118 Query: 141 LAVMSSFPLL 150 LAVMSS PLL Sbjct: 119 LAVMSSLPLL 128 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.134 0.386 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51180865 Number of Sequences: 2977 Number of extensions: 1954663 Number of successful extensions: 7557 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7555 Number of HSP's gapped (non-prelim): 1 length of query: 150 length of database: 189,106,746 effective HSP length: 55 effective length of query: 95 effective length of database: 156,189,961 effective search space: 14838046295 effective search space used: 14838046295 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 161 (67.1 bits)